Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 453410..454137 | Replicon | chromosome |
| Accession | NZ_CP117750 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00700 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PTC84_RS02155 | Protein ID | WP_045348581.1 |
| Coordinates | 453826..454137 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A8B3V464 |
| Locus tag | PTC84_RS02150 | Protein ID | WP_022650546.1 |
| Coordinates | 453410..453829 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC84_RS02140 (PTC84_02140) | 451240..452361 | - | 1122 | WP_015571201.1 | YbdK family carboxylate-amine ligase | - |
| PTC84_RS02145 (PTC84_02145) | 452467..453357 | + | 891 | WP_063933147.1 | oxidoreductase | - |
| PTC84_RS02150 (PTC84_02150) | 453410..453829 | - | 420 | WP_022650546.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PTC84_RS02155 (PTC84_02155) | 453826..454137 | - | 312 | WP_045348581.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PTC84_RS02160 (PTC84_02160) | 454735..456252 | + | 1518 | WP_165468254.1 | hypothetical protein | - |
| PTC84_RS02165 (PTC84_02165) | 456624..456926 | - | 303 | WP_165468255.1 | hypothetical protein | - |
| PTC84_RS02170 (PTC84_02170) | 457171..457773 | + | 603 | WP_023320086.1 | site-specific integrase | - |
| PTC84_RS02175 (PTC84_02175) | 457910..458578 | + | 669 | WP_023296073.1 | epoxyqueuosine reductase QueH | - |
| PTC84_RS02180 (PTC84_02180) | 458802..458996 | - | 195 | WP_223825263.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12562.47 Da Isoelectric Point: 9.9435
>T272239 WP_045348581.1 NZ_CP117750:c454137-453826 [Enterobacter hormaechei]
MHIVSRAPFDTAARHYPNQAQALDDLYRVLKKEHYPLPDEMRKRFPSLDRMKYREKWWVIDVGGGHLRVMFFADFERGKI
FIKHISTHADYDKLMDYYRRTKE
MHIVSRAPFDTAARHYPNQAQALDDLYRVLKKEHYPLPDEMRKRFPSLDRMKYREKWWVIDVGGGHLRVMFFADFERGKI
FIKHISTHADYDKLMDYYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15447.51 Da Isoelectric Point: 4.6051
>AT272239 WP_022650546.1 NZ_CP117750:c453829-453410 [Enterobacter hormaechei]
MNYAAAIKAANALTNELPFLGSSPSRQDYEDALALVEYLIEHDPDNPLVEMLTAKIDKYENESPEFAEFNARIASIPSGV
ALLRTLMDQYQLTQSDFENEIGKKSLVSRILNGQRTLTLDHMRALAKRFGLPVSAFVGN
MNYAAAIKAANALTNELPFLGSSPSRQDYEDALALVEYLIEHDPDNPLVEMLTAKIDKYENESPEFAEFNARIASIPSGV
ALLRTLMDQYQLTQSDFENEIGKKSLVSRILNGQRTLTLDHMRALAKRFGLPVSAFVGN
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|