Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5648051..5648646 | Replicon | chromosome |
Accession | NZ_CP117749 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00828 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PTC91_RS26845 | Protein ID | WP_003113526.1 |
Coordinates | 5648368..5648646 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PTC91_RS26840 | Protein ID | WP_003133769.1 |
Coordinates | 5648051..5648356 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC91_RS26805 (PTC91_26805) | 5643192..5644040 | + | 849 | WP_003095007.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PTC91_RS26815 (PTC91_26815) | 5644207..5645148 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PTC91_RS26820 (PTC91_26820) | 5645265..5645879 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PTC91_RS26825 (PTC91_26825) | 5645921..5646505 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PTC91_RS26830 (PTC91_26830) | 5646546..5647646 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PTC91_RS26840 (PTC91_26840) | 5648051..5648356 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
PTC91_RS26845 (PTC91_26845) | 5648368..5648646 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTC91_RS26850 (PTC91_26850) | 5648699..5648827 | - | 129 | Protein_5307 | integrase | - |
PTC91_RS26855 (PTC91_26855) | 5648975..5651203 | + | 2229 | WP_019485341.1 | TonB-dependent receptor | - |
PTC91_RS26860 (PTC91_26860) | 5651273..5651920 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PTC91_RS26865 (PTC91_26865) | 5651982..5653220 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T272237 WP_003113526.1 NZ_CP117749:c5648646-5648368 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|