Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 358435..359081 | Replicon | chromosome |
Accession | NZ_CP117740 | ||
Organism | Klebsiella pneumoniae strain 2022CK-00768 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A4S7KZ03 |
Locus tag | PTC88_RS01645 | Protein ID | WP_032433636.1 |
Coordinates | 358435..358782 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4S7L580 |
Locus tag | PTC88_RS01650 | Protein ID | WP_019725405.1 |
Coordinates | 358782..359081 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC88_RS01635 (354361) | 354361..355794 | + | 1434 | WP_032433640.1 | glycogen synthase GlgA | - |
PTC88_RS01640 (355812) | 355812..358259 | + | 2448 | WP_032433638.1 | glycogen phosphorylase | - |
PTC88_RS01645 (358435) | 358435..358782 | + | 348 | WP_032433636.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTC88_RS01650 (358782) | 358782..359081 | + | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
PTC88_RS01655 (359144) | 359144..360652 | - | 1509 | WP_029602548.1 | glycerol-3-phosphate dehydrogenase | - |
PTC88_RS01660 (360857) | 360857..361186 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
PTC88_RS01665 (361237) | 361237..362067 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
PTC88_RS01670 (362117) | 362117..362875 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13500.51 Da Isoelectric Point: 6.2327
>T272195 WP_032433636.1 NZ_CP117740:358435-358782 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S7KZ03 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S7L580 |