Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13578..14235 Replicon plasmid unnamed2
Accession NZ_CP117732
Organism Klebsiella grimontii strain 2022CK-00781

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag PTC90_RS29730 Protein ID WP_000270043.1
Coordinates 13885..14235 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PTC90_RS29725 Protein ID WP_000124640.1
Coordinates 13578..13880 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC90_RS29680 (PTC90_29675) 9203..9631 + 429 WP_000591074.1 hypothetical protein -
PTC90_RS29685 (PTC90_29680) 9688..10047 + 360 WP_000422768.1 hypothetical protein -
PTC90_RS29690 (PTC90_29685) 10047..10493 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
PTC90_RS29695 (PTC90_29690) 10490..11008 + 519 WP_000210756.1 nitrite reductase -
PTC90_RS29700 (PTC90_29695) 11008..11238 + 231 WP_000972663.1 hypothetical protein -
PTC90_RS29705 (PTC90_29700) 11225..12082 + 858 WP_001167032.1 hypothetical protein -
PTC90_RS29710 (PTC90_29705) 12313..12840 + 528 WP_001236377.1 thermonuclease family protein -
PTC90_RS29715 (PTC90_29710) 12898..13170 + 273 WP_001043047.1 HU family DNA-binding protein -
PTC90_RS29720 (PTC90_29715) 13258..13551 + 294 WP_001239997.1 chromosome segregation protein ParM -
PTC90_RS29725 (PTC90_29720) 13578..13880 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
PTC90_RS29730 (PTC90_29725) 13885..14235 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PTC90_RS29735 (PTC90_29730) 14398..14946 + 549 WP_001061574.1 transcriptional regulator -
PTC90_RS29740 (PTC90_29735) 15287..15481 + 195 WP_000343597.1 hypothetical protein -
PTC90_RS29745 (PTC90_29740) 15492..15863 + 372 WP_000516916.1 hypothetical protein -
PTC90_RS29750 (PTC90_29745) 15856..16326 + 471 WP_001281821.1 hypothetical protein -
PTC90_RS29755 (PTC90_29750) 16341..16676 - 336 WP_000683476.1 hypothetical protein -
PTC90_RS29760 (PTC90_29755) 16773..17261 + 489 WP_001273096.1 DUF1643 domain-containing protein -
PTC90_RS29765 (PTC90_29760) 17264..17761 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaFOX-5 / blaCARB-2 / aadA2 / cmlA1 / qacE / sul1 / dfrA19 / ant(2'')-Ia / msr(E) - 1..178660 178660


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T272192 WP_000270043.1 NZ_CP117732:c14235-13885 [Klebsiella grimontii]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT272192 WP_000124640.1 NZ_CP117732:c13880-13578 [Klebsiella grimontii]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References