Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3629412..3630072 | Replicon | chromosome |
| Accession | NZ_CP117730 | ||
| Organism | Klebsiella grimontii strain 2022CK-00781 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PTC90_RS17300 | Protein ID | WP_049089248.1 |
| Coordinates | 3629719..3630072 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A9E1DQ94 |
| Locus tag | PTC90_RS17295 | Protein ID | WP_004132739.1 |
| Coordinates | 3629412..3629714 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC90_RS17265 (PTC90_17260) | 3624417..3625871 | + | 1455 | WP_024359975.1 | AMP nucleosidase | - |
| PTC90_RS17275 (PTC90_17270) | 3626900..3628357 | - | 1458 | WP_004136541.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| PTC90_RS17285 (PTC90_17280) | 3628681..3629014 | - | 334 | Protein_3400 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PTC90_RS17290 (PTC90_17285) | 3629015..3629218 | - | 204 | Protein_3401 | hypothetical protein | - |
| PTC90_RS17295 (PTC90_17290) | 3629412..3629714 | - | 303 | WP_004132739.1 | XRE family transcriptional regulator | Antitoxin |
| PTC90_RS17300 (PTC90_17295) | 3629719..3630072 | - | 354 | WP_049089248.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTC90_RS17305 (PTC90_17300) | 3630456..3631874 | - | 1419 | WP_154926204.1 | heavy metal sensor histidine kinase | - |
| PTC90_RS17310 (PTC90_17305) | 3631874..3632542 | - | 669 | WP_004132733.1 | heavy metal response regulator transcription factor | - |
| PTC90_RS17315 (PTC90_17310) | 3632682..3633308 | + | 627 | WP_004132731.1 | hypothetical protein | - |
| PTC90_RS17320 (PTC90_17315) | 3633323..3633931 | + | 609 | WP_154926207.1 | cytochrome b/b6 domain-containing protein | - |
| PTC90_RS17325 (PTC90_17320) | 3633921..3634688 | + | 768 | WP_004132727.1 | molybdopterin-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13639.64 Da Isoelectric Point: 9.8874
>T272188 WP_049089248.1 NZ_CP117730:c3630072-3629719 [Klebsiella grimontii]
VWMIKTTDTFERWFTSLNDTDRARVLAALLVLREKGPGLSRPYADTLRGSRYSDMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
VWMIKTTDTFERWFTSLNDTDRARVLAALLVLREKGPGLSRPYADTLRGSRYSDMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|