Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3674317..3674974 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A808IF03 |
| Locus tag | PTC87_RS17495 | Protein ID | WP_033146338.1 |
| Coordinates | 3674317..3674616 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A808ICP3 |
| Locus tag | PTC87_RS17500 | Protein ID | WP_033146339.1 |
| Coordinates | 3674627..3674974 (+) | Length | 116 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS17485 (PTC87_17485) | 3670685..3672883 | + | 2199 | WP_033146337.1 | type I secretion system permease/ATPase | - |
| PTC87_RS17490 (PTC87_17490) | 3672894..3674063 | + | 1170 | WP_086374946.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| PTC87_RS17495 (PTC87_17495) | 3674317..3674616 | + | 300 | WP_033146338.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTC87_RS17500 (PTC87_17500) | 3674627..3674974 | + | 348 | WP_033146339.1 | HigA family addiction module antitoxin | Antitoxin |
| PTC87_RS17505 (PTC87_17505) | 3675019..3675444 | + | 426 | WP_033146340.1 | nucleoside triphosphatase NudI | - |
| PTC87_RS17510 (PTC87_17510) | 3675416..3676147 | - | 732 | WP_033146341.1 | helix-turn-helix transcriptional regulator | - |
| PTC87_RS17515 (PTC87_17515) | 3676245..3676664 | + | 420 | WP_033146342.1 | nuclear transport factor 2 family protein | - |
| PTC87_RS17520 (PTC87_17520) | 3676667..3677185 | - | 519 | WP_033146343.1 | hypothetical protein | - |
| PTC87_RS17525 (PTC87_17525) | 3677270..3678451 | - | 1182 | WP_033146344.1 | PLP-dependent aminotransferase family protein | - |
| PTC87_RS17530 (PTC87_17530) | 3678471..3679358 | - | 888 | WP_033146345.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11691.32 Da Isoelectric Point: 10.0346
>T272172 WP_033146338.1 NZ_CP117723:3674317-3674616 [Enterobacter asburiae]
MISYFRDQWLEDFFLYGRSSNVIPANLETALARKLDIIRAATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
TEGKAEDLYLSPHKYTQHK
MISYFRDQWLEDFFLYGRSSNVIPANLETALARKLDIIRAATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
TEGKAEDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A808IF03 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A808ICP3 |