Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3000730..3001390 | Replicon | chromosome |
Accession | NZ_CP117723 | ||
Organism | Enterobacter asburiae strain 2022CK-00757 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PTC87_RS14340 | Protein ID | WP_033145931.1 |
Coordinates | 3001037..3001390 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1Z3MX79 |
Locus tag | PTC87_RS14335 | Protein ID | WP_029741460.1 |
Coordinates | 3000730..3001032 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC87_RS14305 (PTC87_14305) | 2996639..2998000 | + | 1362 | WP_003036316.1 | HEPN/Toprim-associated domain-containing protein | - |
PTC87_RS14310 (PTC87_14310) | 2998170..2998364 | + | 195 | WP_080277779.1 | hypothetical protein | - |
PTC87_RS14315 (PTC87_14315) | 2998321..2998653 | - | 333 | WP_033145927.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
PTC87_RS14320 (PTC87_14320) | 2998654..2998911 | - | 258 | WP_033145928.1 | antitoxin | - |
PTC87_RS14325 (PTC87_14325) | 2999203..2999592 | - | 390 | WP_033145929.1 | RidA family protein | - |
PTC87_RS14330 (PTC87_14330) | 2999734..3000654 | + | 921 | WP_033145930.1 | LysR family transcriptional regulator | - |
PTC87_RS14335 (PTC87_14335) | 3000730..3001032 | - | 303 | WP_029741460.1 | XRE family transcriptional regulator | Antitoxin |
PTC87_RS14340 (PTC87_14340) | 3001037..3001390 | - | 354 | WP_033145931.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTC87_RS14345 (PTC87_14345) | 3001568..3002461 | - | 894 | WP_033145932.1 | LysR substrate-binding domain-containing protein | - |
PTC87_RS14350 (PTC87_14350) | 3002632..3003240 | + | 609 | WP_080277780.1 | glutathione S-transferase family protein | - |
PTC87_RS14355 (PTC87_14355) | 3003284..3004234 | - | 951 | WP_023336219.1 | HTH-type transcriptional regulator Cbl | - |
PTC87_RS14360 (PTC87_14360) | 3004331..3005248 | - | 918 | WP_033145933.1 | nitrogen assimilation transcriptional regulator NAC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13577.40 Da Isoelectric Point: 8.0361
>T272170 WP_033145931.1 NZ_CP117723:c3001390-3001037 [Enterobacter asburiae]
VWAINTTDRFDRWFTSLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
MLCAGNKVGNERRFYDEMLLVADQEFTHWLDRLKERE
VWAINTTDRFDRWFTSLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
MLCAGNKVGNERRFYDEMLLVADQEFTHWLDRLKERE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|