Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 84499..85145 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PTC87_RS00365 | Protein ID | WP_033147058.1 |
| Coordinates | 84795..85145 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTC87_RS00360 | Protein ID | WP_023309874.1 |
| Coordinates | 84499..84798 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS00335 (PTC87_00335) | 80222..80983 | + | 762 | WP_033147062.1 | winged helix-turn-helix domain-containing protein | - |
| PTC87_RS00340 (PTC87_00340) | 80985..81464 | + | 480 | WP_033147061.1 | hypothetical protein | - |
| PTC87_RS00345 (PTC87_00345) | 81654..82592 | + | 939 | WP_047059676.1 | helix-turn-helix domain-containing protein | - |
| PTC87_RS00350 (PTC87_00350) | 82678..83676 | + | 999 | WP_033147060.1 | class I SAM-dependent methyltransferase | - |
| PTC87_RS00355 (PTC87_00355) | 84033..84470 | + | 438 | WP_033147059.1 | acetyltransferase | - |
| PTC87_RS00360 (PTC87_00360) | 84499..84798 | - | 300 | WP_023309874.1 | XRE family transcriptional regulator | Antitoxin |
| PTC87_RS00365 (PTC87_00365) | 84795..85145 | - | 351 | WP_033147058.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTC87_RS00375 (PTC87_00375) | 85972..87363 | + | 1392 | WP_033147057.1 | glycoside-pentoside-hexuronide family transporter | - |
| PTC87_RS00380 (PTC87_00380) | 87376..89694 | + | 2319 | WP_033147056.1 | alpha-xylosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13561.65 Da Isoelectric Point: 8.0081
>T272156 WP_033147058.1 NZ_CP117723:c85145-84795 [Enterobacter asburiae]
MWTVLFGKVFEQWLLEQEEGLQDKVLADLLNLQKYGPRLPRPYADTVKGSWYNHMKELRIQYAGRPIRAFFAFDPVRQAI
VLCAGDKSNDKAFYEKMIRIADTEFSFHLTSLEATK
MWTVLFGKVFEQWLLEQEEGLQDKVLADLLNLQKYGPRLPRPYADTVKGSWYNHMKELRIQYAGRPIRAFFAFDPVRQAI
VLCAGDKSNDKAFYEKMIRIADTEFSFHLTSLEATK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|