Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 15635..15889 Replicon plasmid pB1W1
Accession NZ_CP117722
Organism Escherichia coli strain B1W1

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PTA75_RS24245 Protein ID WP_001312851.1
Coordinates 15740..15889 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 15635..15696 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTA75_RS24195 (11088) 11088..11489 + 402 WP_001369361.1 conjugal transfer relaxosome DNA-bindin protein TraY -
PTA75_RS24200 (11522) 11522..11887 + 366 WP_000994779.1 type IV conjugative transfer system pilin TraA -
PTA75_RS24205 (11902) 11902..12213 + 312 WP_000012106.1 type IV conjugative transfer system protein TraL -
PTA75_RS24210 (12235) 12235..12801 + 567 WP_000399792.1 type IV conjugative transfer system protein TraE -
PTA75_RS24215 (12788) 12788..12991 + 204 Protein_25 hypothetical protein -
PTA75_RS24220 (12986) 12986..13129 + 144 Protein_26 TraX family protein -
PTA75_RS24225 (13188) 13188..14048 + 861 WP_000704513.1 alpha/beta hydrolase -
PTA75_RS24230 (14151) 14151..14711 + 561 WP_000139315.1 fertility inhibition protein FinO -
PTA75_RS24235 (14847) 14847..15059 + 213 WP_001299730.1 ANR family transcriptional regulator -
PTA75_RS24240 (15305) 15305..15379 + 75 Protein_30 endonuclease -
- (15635) 15635..15696 - 62 NuclAT_1 - Antitoxin
- (15635) 15635..15696 - 62 NuclAT_1 - Antitoxin
- (15635) 15635..15696 - 62 NuclAT_1 - Antitoxin
- (15635) 15635..15696 - 62 NuclAT_1 - Antitoxin
PTA75_RS24245 (15740) 15740..15889 + 150 WP_001312851.1 Hok/Gef family protein Toxin
PTA75_RS24250 (16173) 16173..16430 + 258 WP_000083845.1 replication regulatory protein RepA -
PTA75_RS24255 (16447) 16447..16698 - 252 WP_223195197.1 replication protein RepA -
PTA75_RS24260 (16689) 16689..16736 + 48 WP_229471593.1 hypothetical protein -
PTA75_RS24265 (16729) 16729..17211 + 483 WP_001273588.1 hypothetical protein -
PTA75_RS24270 (17204) 17204..18061 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
PTA75_RS24275 (19000) 19000..19653 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
PTA75_RS24280 (19746) 19746..20003 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
PTA75_RS24285 (19936) 19936..20337 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
PTA75_RS24290 (20586) 20586..20840 + 255 Protein_40 IS1-like element transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid lnu(F) / aadA22 / tet(A) / aph(3')-Ia / blaCTX-M-55 / aac(3)-IIa / floR / ant(3'')-Ia / sul3 / dfrA14 / sitABCD iucA / iucB / iucC / iucD / iutA 1..108673 108673


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T272152 WP_001312851.1 NZ_CP117722:15740-15889 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT272152 NZ_CP117722:c15696-15635 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References