Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 6098..6367 | Replicon | plasmid pB1W1 |
Accession | NZ_CP117722 | ||
Organism | Escherichia coli strain B1W1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | PTA75_RS24150 | Protein ID | WP_001372321.1 |
Coordinates | 6242..6367 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 6098..6163 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA75_RS24095 | 1317..2288 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
PTA75_RS24100 | 2925..3094 | + | 170 | Protein_2 | hypothetical protein | - |
PTA75_RS24105 | 3277..3357 | - | 81 | Protein_3 | hypothetical protein | - |
PTA75_RS24110 | 3427..3633 | + | 207 | WP_000275856.1 | hypothetical protein | - |
PTA75_RS24115 | 3659..4198 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
PTA75_RS24120 | 4266..4499 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
PTA75_RS24125 | 4527..4724 | + | 198 | Protein_7 | hypothetical protein | - |
PTA75_RS24130 | 4779..5213 | + | 435 | WP_064770609.1 | conjugation system SOS inhibitor PsiB | - |
PTA75_RS24135 | 5210..5972 | + | 763 | Protein_9 | plasmid SOS inhibition protein A | - |
PTA75_RS24140 | 5941..6129 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 5941..6165 | + | 225 | NuclAT_0 | - | - |
- | 5941..6165 | + | 225 | NuclAT_0 | - | - |
- | 5941..6165 | + | 225 | NuclAT_0 | - | - |
- | 5941..6165 | + | 225 | NuclAT_0 | - | - |
- | 6098..6163 | - | 66 | - | - | Antitoxin |
PTA75_RS24145 | 6151..6300 | + | 150 | Protein_11 | plasmid maintenance protein Mok | - |
PTA75_RS24150 | 6242..6367 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
PTA75_RS24155 | 6587..6817 | + | 231 | WP_001426396.1 | hypothetical protein | - |
PTA75_RS24160 | 6815..6988 | - | 174 | Protein_14 | hypothetical protein | - |
PTA75_RS24165 | 7058..7264 | + | 207 | WP_000547971.1 | hypothetical protein | - |
PTA75_RS24170 | 7289..7576 | + | 288 | WP_000107535.1 | hypothetical protein | - |
PTA75_RS24175 | 7695..8516 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
PTA75_RS24180 | 8813..9415 | - | 603 | WP_072156291.1 | transglycosylase SLT domain-containing protein | - |
PTA75_RS24185 | 9736..10119 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
PTA75_RS24190 | 10306..10995 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | lnu(F) / aadA22 / tet(A) / aph(3')-Ia / blaCTX-M-55 / aac(3)-IIa / floR / ant(3'')-Ia / sul3 / dfrA14 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..108673 | 108673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T272150 WP_001372321.1 NZ_CP117722:6242-6367 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT272150 NZ_CP117722:c6163-6098 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|