Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1128814..1129541 | Replicon | chromosome |
Accession | NZ_CP117720 | ||
Organism | Escherichia coli strain B1W1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | PTA75_RS05545 | Protein ID | WP_000547564.1 |
Coordinates | 1128814..1129125 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PTA75_RS05550 | Protein ID | WP_000126294.1 |
Coordinates | 1129122..1129541 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA75_RS05515 (1123956) | 1123956..1125665 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
PTA75_RS05520 (1125675) | 1125675..1126217 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
PTA75_RS05525 (1126217) | 1126217..1126984 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
PTA75_RS05530 (1126981) | 1126981..1127391 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
PTA75_RS05535 (1127384) | 1127384..1127854 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
PTA75_RS05540 (1127879) | 1127879..1128640 | + | 762 | WP_001026446.1 | hypothetical protein | - |
PTA75_RS05545 (1128814) | 1128814..1129125 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PTA75_RS05550 (1129122) | 1129122..1129541 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
PTA75_RS05555 (1129655) | 1129655..1131079 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
PTA75_RS05560 (1131088) | 1131088..1132544 | - | 1457 | Protein_1091 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
PTA75_RS05565 (1132804) | 1132804..1133814 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
PTA75_RS05570 (1133963) | 1133963..1134490 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T272137 WP_000547564.1 NZ_CP117720:1128814-1129125 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT272137 WP_000126294.1 NZ_CP117720:1129122-1129541 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|