Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 48850..49104 Replicon plasmid pB1S11
Accession NZ_CP117718
Organism Escherichia coli strain B1S11

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PTA69_RS24375 Protein ID WP_001312851.1
Coordinates 48955..49104 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 48850..48911 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTA69_RS24350 (45598) 45598..46344 + 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -
PTA69_RS24355 (46403) 46403..47263 + 861 WP_000704514.1 alpha/beta hydrolase -
PTA69_RS24360 (47366) 47366..47926 + 561 WP_000139315.1 fertility inhibition protein FinO -
PTA69_RS24365 (48062) 48062..48274 + 213 WP_001299730.1 ANR family transcriptional regulator -
PTA69_RS24370 (48520) 48520..48594 + 75 Protein_61 endonuclease -
- (48850) 48850..48911 - 62 NuclAT_1 - Antitoxin
- (48850) 48850..48911 - 62 NuclAT_1 - Antitoxin
- (48850) 48850..48911 - 62 NuclAT_1 - Antitoxin
- (48850) 48850..48911 - 62 NuclAT_1 - Antitoxin
PTA69_RS24375 (48955) 48955..49104 + 150 WP_001312851.1 Hok/Gef family protein Toxin
PTA69_RS24380 (49388) 49388..49645 + 258 WP_000083845.1 replication regulatory protein RepA -
PTA69_RS24385 (49662) 49662..49913 - 252 WP_223195197.1 replication protein RepA -
PTA69_RS24390 (49904) 49904..49951 + 48 WP_229471593.1 hypothetical protein -
PTA69_RS24395 (49944) 49944..50426 + 483 WP_001273588.1 hypothetical protein -
PTA69_RS24400 (50419) 50419..51276 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
PTA69_RS24405 (51977) 51977..52117 + 141 WP_001333237.1 hypothetical protein -
PTA69_RS24410 (52215) 52215..52868 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
PTA69_RS24415 (52961) 52961..53218 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
PTA69_RS24420 (53151) 53151..53552 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / tet(A) / qnrS1 / dfrA14 / blaTEM-1C / sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..151146 151146


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T272126 WP_001312851.1 NZ_CP117718:48955-49104 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT272126 NZ_CP117718:c48911-48850 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References