Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 48850..49104 | Replicon | plasmid pB1S11 |
Accession | NZ_CP117718 | ||
Organism | Escherichia coli strain B1S11 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | PTA69_RS24375 | Protein ID | WP_001312851.1 |
Coordinates | 48955..49104 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 48850..48911 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA69_RS24350 (45598) | 45598..46344 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
PTA69_RS24355 (46403) | 46403..47263 | + | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
PTA69_RS24360 (47366) | 47366..47926 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
PTA69_RS24365 (48062) | 48062..48274 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
PTA69_RS24370 (48520) | 48520..48594 | + | 75 | Protein_61 | endonuclease | - |
- (48850) | 48850..48911 | - | 62 | NuclAT_1 | - | Antitoxin |
- (48850) | 48850..48911 | - | 62 | NuclAT_1 | - | Antitoxin |
- (48850) | 48850..48911 | - | 62 | NuclAT_1 | - | Antitoxin |
- (48850) | 48850..48911 | - | 62 | NuclAT_1 | - | Antitoxin |
PTA69_RS24375 (48955) | 48955..49104 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
PTA69_RS24380 (49388) | 49388..49645 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
PTA69_RS24385 (49662) | 49662..49913 | - | 252 | WP_223195197.1 | replication protein RepA | - |
PTA69_RS24390 (49904) | 49904..49951 | + | 48 | WP_229471593.1 | hypothetical protein | - |
PTA69_RS24395 (49944) | 49944..50426 | + | 483 | WP_001273588.1 | hypothetical protein | - |
PTA69_RS24400 (50419) | 50419..51276 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
PTA69_RS24405 (51977) | 51977..52117 | + | 141 | WP_001333237.1 | hypothetical protein | - |
PTA69_RS24410 (52215) | 52215..52868 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
PTA69_RS24415 (52961) | 52961..53218 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
PTA69_RS24420 (53151) | 53151..53552 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | floR / tet(A) / qnrS1 / dfrA14 / blaTEM-1C / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..151146 | 151146 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T272126 WP_001312851.1 NZ_CP117718:48955-49104 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT272126 NZ_CP117718:c48911-48850 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|