Detailed information of TA system TA272122

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 5941..6367
• Replicon: plasmid pB1S11
• Accession: NZ_CP117718
• Organism: Escherichia coli strain B1S11

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PTA69_RS24125
• Protein ID: WP_001372321.1
• Coordinates: 6242..6367 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	5941..6165 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PTA69_RS24070 (1317)	1317..2288	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
PTA69_RS24075 (2925)	2925..3094	+	170	Protein_2	hypothetical protein	-
PTA69_RS24080 (3277)	3277..3357	-	81	Protein_3	hypothetical protein	-
PTA69_RS24085 (3427)	3427..3633	+	207	WP_000275856.1	hypothetical protein	-
PTA69_RS24090 (3659)	3659..4198	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
PTA69_RS24095 (4266)	4266..4499	+	234	WP_000005987.1	DUF905 family protein	-
PTA69_RS24100 (4527)	4527..4724	+	198	Protein_7	hypothetical protein	-
PTA69_RS24105 (4779)	4779..5213	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PTA69_RS24110 (5210)	5210..5972	+	763	Protein_9	plasmid SOS inhibition protein A	-
PTA69_RS24115 (5941)	5941..6129	-	189	WP_001299721.1	hypothetical protein	-
- (5941)	5941..6165	+	225	NuclAT_0	-	Antitoxin
- (5941)	5941..6165	+	225	NuclAT_0	-	Antitoxin
- (5941)	5941..6165	+	225	NuclAT_0	-	Antitoxin
- (5941)	5941..6165	+	225	NuclAT_0	-	Antitoxin
PTA69_RS24120 (6151)	6151..6300	+	150	Protein_11	plasmid maintenance protein Mok	-
PTA69_RS24125 (6242)	6242..6367	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PTA69_RS24130 (6587)	6587..6817	+	231	WP_071586998.1	hypothetical protein	-
PTA69_RS24135 (6815)	6815..6987	-	173	Protein_14	hypothetical protein	-
PTA69_RS24140 (7057)	7057..7281	+	225	WP_107193629.1	single-stranded DNA-binding protein	-
PTA69_RS24145 (7753)	7753..9225	-	1473	WP_273925326.1	caspase family protein	-
PTA69_RS24150 (9608)	9608..10267	-	660	Protein_17	transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	floR / tet(A) / qnrS1 / dfrA14 / blaTEM-1C / sitABCD	iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..151146	151146

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T272122 WP_001372321.1 NZ_CP117718:6242-6367 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT272122 NZ_CP117718:5941-6165 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin