Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4734099..4734701 | Replicon | chromosome |
Accession | NZ_CP117717 | ||
Organism | Escherichia coli strain B1S11 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | PTA69_RS23065 | Protein ID | WP_000897305.1 |
Coordinates | 4734390..4734701 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PTA69_RS23060 | Protein ID | WP_000356397.1 |
Coordinates | 4734099..4734389 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA69_RS23035 (4730025) | 4730025..4730927 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PTA69_RS23040 (4730924) | 4730924..4731559 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PTA69_RS23045 (4731556) | 4731556..4732485 | + | 930 | WP_001749031.1 | formate dehydrogenase accessory protein FdhE | - |
PTA69_RS23050 (4732815) | 4732815..4733057 | - | 243 | WP_001086388.1 | protein YiiF | - |
PTA69_RS23055 (4733276) | 4733276..4733494 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
PTA69_RS23060 (4734099) | 4734099..4734389 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PTA69_RS23065 (4734390) | 4734390..4734701 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
PTA69_RS23070 (4734930) | 4734930..4735838 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
PTA69_RS23075 (4735902) | 4735902..4736843 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
PTA69_RS23080 (4736888) | 4736888..4737325 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PTA69_RS23085 (4737322) | 4737322..4738194 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PTA69_RS23090 (4738188) | 4738188..4738787 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
PTA69_RS23095 (4738886) | 4738886..4739671 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T272121 WP_000897305.1 NZ_CP117717:c4734701-4734390 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|