Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 44406..44660 | Replicon | plasmid pPBS4 |
| Accession | NZ_CP117716 | ||
| Organism | Escherichia coli strain PBS4 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PTA50_RS24410 | Protein ID | WP_001312851.1 |
| Coordinates | 44511..44660 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 44406..44467 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA50_RS24385 (41154) | 41154..41900 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| PTA50_RS24390 (41959) | 41959..42819 | + | 861 | WP_273792132.1 | alpha/beta hydrolase | - |
| PTA50_RS24395 (42922) | 42922..43482 | + | 561 | WP_112917249.1 | fertility inhibition protein FinO | - |
| PTA50_RS24400 (43618) | 43618..43830 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PTA50_RS24405 (44076) | 44076..44150 | + | 75 | Protein_58 | endonuclease | - |
| - (44406) | 44406..44467 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (44406) | 44406..44467 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (44406) | 44406..44467 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (44406) | 44406..44467 | - | 62 | NuclAT_1 | - | Antitoxin |
| PTA50_RS24410 (44511) | 44511..44660 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| PTA50_RS24415 (44944) | 44944..45201 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PTA50_RS24420 (45218) | 45218..45469 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| PTA50_RS24425 (45460) | 45460..45507 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| PTA50_RS24430 (45500) | 45500..45982 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| PTA50_RS24435 (45975) | 45975..46832 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PTA50_RS24440 (47533) | 47533..47673 | + | 141 | WP_001333237.1 | hypothetical protein | - |
| PTA50_RS24445 (47771) | 47771..48424 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| PTA50_RS24450 (48517) | 48517..48774 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| PTA50_RS24455 (48707) | 48707..49108 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / floR / aph(3')-Ia / dfrA14 / blaCTX-M-55 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..137545 | 137545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T272102 WP_001312851.1 NZ_CP117716:44511-44660 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT272102 NZ_CP117716:c44467-44406 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|