Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 44406..44660 Replicon plasmid pPBS4
Accession NZ_CP117716
Organism Escherichia coli strain PBS4

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PTA50_RS24410 Protein ID WP_001312851.1
Coordinates 44511..44660 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 44406..44467 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTA50_RS24385 (41154) 41154..41900 + 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -
PTA50_RS24390 (41959) 41959..42819 + 861 WP_273792132.1 alpha/beta hydrolase -
PTA50_RS24395 (42922) 42922..43482 + 561 WP_112917249.1 fertility inhibition protein FinO -
PTA50_RS24400 (43618) 43618..43830 + 213 WP_001299730.1 ANR family transcriptional regulator -
PTA50_RS24405 (44076) 44076..44150 + 75 Protein_58 endonuclease -
- (44406) 44406..44467 - 62 NuclAT_1 - Antitoxin
- (44406) 44406..44467 - 62 NuclAT_1 - Antitoxin
- (44406) 44406..44467 - 62 NuclAT_1 - Antitoxin
- (44406) 44406..44467 - 62 NuclAT_1 - Antitoxin
PTA50_RS24410 (44511) 44511..44660 + 150 WP_001312851.1 Hok/Gef family protein Toxin
PTA50_RS24415 (44944) 44944..45201 + 258 WP_000083845.1 replication regulatory protein RepA -
PTA50_RS24420 (45218) 45218..45469 - 252 WP_223195197.1 replication protein RepA -
PTA50_RS24425 (45460) 45460..45507 + 48 WP_229471593.1 hypothetical protein -
PTA50_RS24430 (45500) 45500..45982 + 483 WP_001273588.1 hypothetical protein -
PTA50_RS24435 (45975) 45975..46832 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
PTA50_RS24440 (47533) 47533..47673 + 141 WP_001333237.1 hypothetical protein -
PTA50_RS24445 (47771) 47771..48424 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
PTA50_RS24450 (48517) 48517..48774 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
PTA50_RS24455 (48707) 48707..49108 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / floR / aph(3')-Ia / dfrA14 / blaCTX-M-55 / sitABCD iucA / iucB / iucC / iucD / iutA 1..137545 137545


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T272102 WP_001312851.1 NZ_CP117716:44511-44660 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT272102 NZ_CP117716:c44467-44406 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References