Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 5941..6367 | Replicon | plasmid pPBS4 |
| Accession | NZ_CP117716 | ||
| Organism | Escherichia coli strain PBS4 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PTA50_RS24175 | Protein ID | WP_001372321.1 |
| Coordinates | 6242..6367 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 5941..6165 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA50_RS24120 (1317) | 1317..2288 | + | 972 | WP_112917248.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| PTA50_RS24125 (2925) | 2925..3094 | + | 170 | Protein_2 | hypothetical protein | - |
| PTA50_RS24130 (3277) | 3277..3357 | - | 81 | Protein_3 | hypothetical protein | - |
| PTA50_RS24135 (3427) | 3427..3633 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| PTA50_RS24140 (3659) | 3659..4198 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| PTA50_RS24145 (4266) | 4266..4499 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| PTA50_RS24150 (4527) | 4527..4724 | + | 198 | Protein_7 | hypothetical protein | - |
| PTA50_RS24155 (4779) | 4779..5213 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| PTA50_RS24160 (5210) | 5210..5972 | + | 763 | Protein_9 | plasmid SOS inhibition protein A | - |
| PTA50_RS24165 (5941) | 5941..6129 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (5941) | 5941..6165 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (5941) | 5941..6165 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (5941) | 5941..6165 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (5941) | 5941..6165 | + | 225 | NuclAT_0 | - | Antitoxin |
| PTA50_RS24170 (6151) | 6151..6300 | + | 150 | Protein_11 | plasmid maintenance protein Mok | - |
| PTA50_RS24175 (6242) | 6242..6367 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PTA50_RS24180 (6587) | 6587..6817 | + | 231 | WP_071586998.1 | hypothetical protein | - |
| PTA50_RS24185 (6815) | 6815..6987 | - | 173 | Protein_14 | hypothetical protein | - |
| PTA50_RS24190 (7057) | 7057..7263 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| PTA50_RS24195 (7288) | 7288..7575 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| PTA50_RS24200 (7693) | 7693..8514 | + | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| PTA50_RS24205 (8811) | 8811..9413 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| PTA50_RS24210 (9734) | 9734..10117 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PTA50_RS24215 (10304) | 10304..10993 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / floR / aph(3')-Ia / dfrA14 / blaCTX-M-55 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..137545 | 137545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T272098 WP_001372321.1 NZ_CP117716:6242-6367 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT272098 NZ_CP117716:5941-6165 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|