Detailed information of TA system TA272098

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 5941..6367
• Replicon: plasmid pPBS4
• Accession: NZ_CP117716
• Organism: Escherichia coli strain PBS4

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PTA50_RS24175
• Protein ID: WP_001372321.1
• Coordinates: 6242..6367 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	5941..6165 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PTA50_RS24120 (1317)	1317..2288	+	972	WP_112917248.1	ParB/RepB/Spo0J family plasmid partition protein	-
PTA50_RS24125 (2925)	2925..3094	+	170	Protein_2	hypothetical protein	-
PTA50_RS24130 (3277)	3277..3357	-	81	Protein_3	hypothetical protein	-
PTA50_RS24135 (3427)	3427..3633	+	207	WP_000275856.1	hypothetical protein	-
PTA50_RS24140 (3659)	3659..4198	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
PTA50_RS24145 (4266)	4266..4499	+	234	WP_000005987.1	DUF905 family protein	-
PTA50_RS24150 (4527)	4527..4724	+	198	Protein_7	hypothetical protein	-
PTA50_RS24155 (4779)	4779..5213	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PTA50_RS24160 (5210)	5210..5972	+	763	Protein_9	plasmid SOS inhibition protein A	-
PTA50_RS24165 (5941)	5941..6129	-	189	WP_001299721.1	hypothetical protein	-
- (5941)	5941..6165	+	225	NuclAT_0	-	Antitoxin
- (5941)	5941..6165	+	225	NuclAT_0	-	Antitoxin
- (5941)	5941..6165	+	225	NuclAT_0	-	Antitoxin
- (5941)	5941..6165	+	225	NuclAT_0	-	Antitoxin
PTA50_RS24170 (6151)	6151..6300	+	150	Protein_11	plasmid maintenance protein Mok	-
PTA50_RS24175 (6242)	6242..6367	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PTA50_RS24180 (6587)	6587..6817	+	231	WP_071586998.1	hypothetical protein	-
PTA50_RS24185 (6815)	6815..6987	-	173	Protein_14	hypothetical protein	-
PTA50_RS24190 (7057)	7057..7263	+	207	WP_000547968.1	hypothetical protein	-
PTA50_RS24195 (7288)	7288..7575	+	288	WP_000107535.1	hypothetical protein	-
PTA50_RS24200 (7693)	7693..8514	+	822	WP_001234426.1	DUF932 domain-containing protein	-
PTA50_RS24205 (8811)	8811..9413	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
PTA50_RS24210 (9734)	9734..10117	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PTA50_RS24215 (10304)	10304..10993	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / floR / aph(3')-Ia / dfrA14 / blaCTX-M-55 / sitABCD	iucA / iucB / iucC / iucD / iutA	1..137545	137545

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T272098 WP_001372321.1 NZ_CP117716:6242-6367 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT272098 NZ_CP117716:5941-6165 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin