Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4675026..4675628 | Replicon | chromosome |
| Accession | NZ_CP117714 | ||
| Organism | Escherichia coli strain PBS4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | PTA50_RS22615 | Protein ID | WP_000897305.1 |
| Coordinates | 4675317..4675628 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTA50_RS22610 | Protein ID | WP_000356397.1 |
| Coordinates | 4675026..4675316 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA50_RS22585 (4670951) | 4670951..4671853 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| PTA50_RS22590 (4671850) | 4671850..4672485 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PTA50_RS22595 (4672482) | 4672482..4673411 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| PTA50_RS22600 (4673741) | 4673741..4673983 | - | 243 | WP_001087409.1 | protein YiiF | - |
| PTA50_RS22605 (4674203) | 4674203..4674421 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| PTA50_RS22610 (4675026) | 4675026..4675316 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PTA50_RS22615 (4675317) | 4675317..4675628 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| PTA50_RS22620 (4675857) | 4675857..4676765 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| PTA50_RS22625 (4676829) | 4676829..4677770 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PTA50_RS22630 (4677815) | 4677815..4678252 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| PTA50_RS22635 (4678249) | 4678249..4679121 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PTA50_RS22640 (4679115) | 4679115..4679714 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| PTA50_RS22645 (4679813) | 4679813..4680598 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T272096 WP_000897305.1 NZ_CP117714:c4675628-4675317 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|