Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 596748..597547 | Replicon | chromosome |
Accession | NZ_CP117714 | ||
Organism | Escherichia coli strain PBS4 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A6H2GMC5 |
Locus tag | PTA50_RS02935 | Protein ID | WP_000347279.1 |
Coordinates | 596748..597212 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PTA50_RS02940 | Protein ID | WP_001307405.1 |
Coordinates | 597212..597547 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA50_RS02905 (591749) | 591749..592183 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PTA50_RS02910 (592201) | 592201..593079 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PTA50_RS02915 (593069) | 593069..593848 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PTA50_RS02920 (593859) | 593859..594332 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PTA50_RS02925 (594355) | 594355..595635 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PTA50_RS02930 (595884) | 595884..596693 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PTA50_RS02935 (596748) | 596748..597212 | - | 465 | WP_000347279.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PTA50_RS02940 (597212) | 597212..597547 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PTA50_RS02945 (597696) | 597696..599267 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
PTA50_RS02950 (599642) | 599642..600976 | + | 1335 | WP_128995326.1 | galactarate/glucarate/glycerate transporter GarP | - |
PTA50_RS02955 (600992) | 600992..601762 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17869.24 Da Isoelectric Point: 9.4947
>T272079 WP_000347279.1 NZ_CP117714:c597212-596748 [Escherichia coli]
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H2GMC5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |