Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4492667..4493421 | Replicon | chromosome |
| Accession | NZ_CP117698 | ||
| Organism | Salmonella enterica subsp. enterica serovar London strain L1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | PRJ38_RS21625 | Protein ID | WP_000558163.1 |
| Coordinates | 4492667..4492978 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PRJ38_RS21630 | Protein ID | WP_001259011.1 |
| Coordinates | 4492975..4493421 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRJ38_RS21595 (4487900) | 4487900..4488535 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PRJ38_RS21600 (4488532) | 4488532..4489461 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PRJ38_RS21605 (4489508) | 4489508..4489798 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PRJ38_RS21610 (4489799) | 4489799..4490110 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PRJ38_RS21615 (4490337) | 4490337..4491557 | - | 1221 | WP_000343760.1 | ISL3-like element ISKox3 family transposase | - |
| PRJ38_RS21620 (4491652) | 4491652..4492581 | + | 930 | WP_023255277.1 | alpha/beta hydrolase | - |
| PRJ38_RS21625 (4492667) | 4492667..4492978 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PRJ38_RS21630 (4492975) | 4492975..4493421 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PRJ38_RS21635 (4493436) | 4493436..4494377 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PRJ38_RS21640 (4494422) | 4494422..4494859 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| PRJ38_RS21645 (4494856) | 4494856..4495728 | - | 873 | WP_023255278.1 | virulence factor BrkB family protein | - |
| PRJ38_RS21650 (4495722) | 4495722..4496321 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PRJ38_RS21655 (4496512) | 4496512..4497315 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PRJ38_RS21660 (4497349) | 4497349..4498245 | - | 897 | WP_001651900.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4490337..4491557 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T272073 WP_000558163.1 NZ_CP117698:4492667-4492978 [Salmonella enterica subsp. enterica serovar London]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT272073 WP_001259011.1 NZ_CP117698:4492975-4493421 [Salmonella enterica subsp. enterica serovar London]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|