Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2299285..2299807 | Replicon | chromosome |
Accession | NZ_CP117698 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain L1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PRJ38_RS11055 | Protein ID | WP_000221343.1 |
Coordinates | 2299523..2299807 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PRJ38_RS11050 | Protein ID | WP_000885424.1 |
Coordinates | 2299285..2299533 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRJ38_RS11025 (2295378) | 2295378..2296844 | + | 1467 | WP_077946914.1 | hypothetical protein | - |
PRJ38_RS11030 (2297146) | 2297146..2297436 | + | 291 | WP_000742001.1 | hypothetical protein | - |
PRJ38_RS11035 (2297789) | 2297789..2298515 | + | 727 | Protein_2157 | helix-turn-helix domain-containing protein | - |
PRJ38_RS11040 (2298596) | 2298596..2298928 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
PRJ38_RS11045 (2298918) | 2298918..2299133 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PRJ38_RS11050 (2299285) | 2299285..2299533 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PRJ38_RS11055 (2299523) | 2299523..2299807 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PRJ38_RS11060 (2299978) | 2299978..2300367 | + | 390 | WP_000194089.1 | RidA family protein | - |
PRJ38_RS11065 (2300419) | 2300419..2301498 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PRJ38_RS11070 (2301691) | 2301691..2302179 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PRJ38_RS11075 (2302224) | 2302224..2303732 | + | 1509 | WP_058214747.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2295381..2306589 | 11208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T272065 WP_000221343.1 NZ_CP117698:2299523-2299807 [Salmonella enterica subsp. enterica serovar London]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |