Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4602319..4603073 | Replicon | chromosome |
| Accession | NZ_CP117696 | ||
| Organism | Salmonella enterica subsp. enterica serovar London strain F1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | PTQ22_RS22215 | Protein ID | WP_000558163.1 |
| Coordinates | 4602319..4602630 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTQ22_RS22220 | Protein ID | WP_001259011.1 |
| Coordinates | 4602627..4603073 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTQ22_RS22185 (4597552) | 4597552..4598187 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PTQ22_RS22190 (4598184) | 4598184..4599113 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PTQ22_RS22195 (4599160) | 4599160..4599450 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PTQ22_RS22200 (4599451) | 4599451..4599762 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PTQ22_RS22205 (4599989) | 4599989..4601209 | - | 1221 | WP_000343760.1 | ISL3-like element ISKox3 family transposase | - |
| PTQ22_RS22210 (4601304) | 4601304..4602233 | + | 930 | WP_023255277.1 | alpha/beta hydrolase | - |
| PTQ22_RS22215 (4602319) | 4602319..4602630 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PTQ22_RS22220 (4602627) | 4602627..4603073 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PTQ22_RS22225 (4603088) | 4603088..4604029 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PTQ22_RS22230 (4604074) | 4604074..4604511 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| PTQ22_RS22235 (4604508) | 4604508..4605380 | - | 873 | WP_023255278.1 | virulence factor BrkB family protein | - |
| PTQ22_RS22240 (4605374) | 4605374..4605973 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PTQ22_RS22245 (4606164) | 4606164..4606967 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PTQ22_RS22250 (4607001) | 4607001..4607897 | - | 897 | WP_001651900.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4599989..4601209 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T272056 WP_000558163.1 NZ_CP117696:4602319-4602630 [Salmonella enterica subsp. enterica serovar London]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT272056 WP_001259011.1 NZ_CP117696:4602627-4603073 [Salmonella enterica subsp. enterica serovar London]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|