Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2300212..2300734 | Replicon | chromosome |
Accession | NZ_CP117696 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain F1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PTQ22_RS11055 | Protein ID | WP_000221343.1 |
Coordinates | 2300450..2300734 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PTQ22_RS11050 | Protein ID | WP_000885424.1 |
Coordinates | 2300212..2300460 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ22_RS11025 (2296305) | 2296305..2297771 | + | 1467 | WP_077946914.1 | hypothetical protein | - |
PTQ22_RS11030 (2298073) | 2298073..2298363 | + | 291 | WP_000742001.1 | hypothetical protein | - |
PTQ22_RS11035 (2298716) | 2298716..2299442 | + | 727 | Protein_2158 | helix-turn-helix domain-containing protein | - |
PTQ22_RS11040 (2299523) | 2299523..2299855 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
PTQ22_RS11045 (2299845) | 2299845..2300060 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PTQ22_RS11050 (2300212) | 2300212..2300460 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTQ22_RS11055 (2300450) | 2300450..2300734 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTQ22_RS11060 (2300905) | 2300905..2301294 | + | 390 | WP_000194089.1 | RidA family protein | - |
PTQ22_RS11065 (2301346) | 2301346..2302425 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PTQ22_RS11070 (2302618) | 2302618..2303106 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PTQ22_RS11075 (2303151) | 2303151..2304659 | + | 1509 | WP_058214747.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2296308..2307516 | 11208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T272048 WP_000221343.1 NZ_CP117696:2300450-2300734 [Salmonella enterica subsp. enterica serovar London]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |