Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4601681..4602435 | Replicon | chromosome |
| Accession | NZ_CP117693 | ||
| Organism | Salmonella enterica subsp. enterica serovar London strain S1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | PTQ18_RS22220 | Protein ID | WP_000558163.1 |
| Coordinates | 4601681..4601992 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTQ18_RS22225 | Protein ID | WP_001259011.1 |
| Coordinates | 4601989..4602435 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTQ18_RS22190 (4596914) | 4596914..4597549 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PTQ18_RS22195 (4597546) | 4597546..4598475 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PTQ18_RS22200 (4598522) | 4598522..4598812 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PTQ18_RS22205 (4598813) | 4598813..4599124 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PTQ18_RS22210 (4599351) | 4599351..4600571 | - | 1221 | WP_000343760.1 | ISL3-like element ISKox3 family transposase | - |
| PTQ18_RS22215 (4600666) | 4600666..4601595 | + | 930 | WP_023255277.1 | alpha/beta hydrolase | - |
| PTQ18_RS22220 (4601681) | 4601681..4601992 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PTQ18_RS22225 (4601989) | 4601989..4602435 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PTQ18_RS22230 (4602450) | 4602450..4603391 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PTQ18_RS22235 (4603436) | 4603436..4603873 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| PTQ18_RS22240 (4603870) | 4603870..4604742 | - | 873 | WP_023255278.1 | virulence factor BrkB family protein | - |
| PTQ18_RS22245 (4604736) | 4604736..4605335 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PTQ18_RS22250 (4605526) | 4605526..4606329 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PTQ18_RS22255 (4606363) | 4606363..4607259 | - | 897 | WP_001651900.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4599351..4600571 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T272039 WP_000558163.1 NZ_CP117693:4601681-4601992 [Salmonella enterica subsp. enterica serovar London]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT272039 WP_001259011.1 NZ_CP117693:4601989-4602435 [Salmonella enterica subsp. enterica serovar London]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|