Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2299146..2299668 | Replicon | chromosome |
Accession | NZ_CP117693 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain S1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PTQ18_RS11045 | Protein ID | WP_000221343.1 |
Coordinates | 2299384..2299668 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PTQ18_RS11040 | Protein ID | WP_000885424.1 |
Coordinates | 2299146..2299394 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTQ18_RS11015 (2295239) | 2295239..2296705 | + | 1467 | WP_077946914.1 | hypothetical protein | - |
PTQ18_RS11020 (2297007) | 2297007..2297297 | + | 291 | WP_000742001.1 | hypothetical protein | - |
PTQ18_RS11025 (2297650) | 2297650..2298376 | + | 727 | Protein_2156 | helix-turn-helix domain-containing protein | - |
PTQ18_RS11030 (2298457) | 2298457..2298789 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
PTQ18_RS11035 (2298779) | 2298779..2298994 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PTQ18_RS11040 (2299146) | 2299146..2299394 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTQ18_RS11045 (2299384) | 2299384..2299668 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTQ18_RS11050 (2299839) | 2299839..2300228 | + | 390 | WP_000194089.1 | RidA family protein | - |
PTQ18_RS11055 (2300280) | 2300280..2301359 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PTQ18_RS11060 (2301552) | 2301552..2302040 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PTQ18_RS11065 (2302085) | 2302085..2303593 | + | 1509 | WP_058214747.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2295242..2306450 | 11208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T272031 WP_000221343.1 NZ_CP117693:2299384-2299668 [Salmonella enterica subsp. enterica serovar London]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |