Detailed information of TA system TA272018

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 21464..21890
• Replicon: plasmid pEA4_63
• Accession: NZ_CP117681
• Organism: Escherichia albertii strain BIA_4

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PS033_RS24705
• Protein ID: WP_001372321.1
• Coordinates: 21765..21890 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	21464..21688 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS033_RS24660 (16659)	16659..17075	-	417	Protein_19	hypothetical protein	-
PS033_RS24665 (17145)	17145..17351	+	207	WP_069894508.1	single-stranded DNA-binding protein	-
PS033_RS24670 (17377)	17377..17913	+	537	WP_127766623.1	single-stranded DNA-binding protein	-
PS033_RS24675 (17970)	17970..18203	+	234	WP_000006026.1	DUF905 domain-containing protein	-
PS033_RS24680 (18269)	18269..20233	+	1965	WP_273780558.1	ParB/RepB/Spo0J family partition protein	-
PS033_RS24685 (20302)	20302..20736	+	435	WP_115443023.1	conjugation system SOS inhibitor PsiB	-
PS033_RS24690 (20733)	20733..21495	+	763	Protein_25	plasmid SOS inhibition protein A	-
PS033_RS24695 (21464)	21464..21652	-	189	WP_001299721.1	hypothetical protein	-
- (21621)	21621..21686	+	66	NuclAT_1	-	-
- (21621)	21621..21686	-	66	NuclAT_0	-	-
- (21464)	21464..21688	+	225	NuclAT_0	-	Antitoxin
- (21464)	21464..21688	+	225	NuclAT_0	-	Antitoxin
- (21464)	21464..21688	+	225	NuclAT_0	-	Antitoxin
- (21464)	21464..21688	+	225	NuclAT_0	-	Antitoxin
- (21464)	21464..21688	-	225	NuclAT_0	-	-
PS033_RS24700 (21674)	21674..21823	+	150	Protein_27	plasmid maintenance protein Mok	-
PS033_RS24705 (21765)	21765..21890	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PS033_RS24710 (22191)	22191..22487	-	297	Protein_29	hypothetical protein	-
PS033_RS24715 (22557)	22557..22763	+	207	WP_000547944.1	hypothetical protein	-
PS033_RS24720 (22787)	22787..23083	+	297	WP_032083169.1	hypothetical protein	-
PS033_RS24725 (23242)	23242..23484	+	243	WP_000540591.1	hypothetical protein	-
PS033_RS24730 (23481)	23481..23600	+	120	Protein_33	class I SAM-dependent methyltransferase	-
PS033_RS24735 (23689)	23689..24105	-	417	Protein_34	hypothetical protein	-
PS033_RS24740 (24175)	24175..24381	+	207	WP_273780559.1	single-stranded DNA-binding protein	-
PS033_RS24745 (24404)	24404..24685	+	282	WP_004027420.1	hypothetical protein	-
PS033_RS24750 (24805)	24805..25626	+	822	WP_182140415.1	DUF932 domain-containing protein	-
PS033_RS24755 (25905)	25905..26357	-	453	WP_024212709.1	transglycosylase SLT domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T272018 WP_001372321.1 NZ_CP117681:21765-21890 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT272018 NZ_CP117681:21464-21688 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin