Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3803589..3803847 | Replicon | chromosome |
Accession | NZ_CP117678 | ||
Organism | Escherichia albertii strain BIA_4 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | PS033_RS18715 | Protein ID | WP_000809168.1 |
Coordinates | 3803589..3803741 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3803790..3803847 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS033_RS18700 | 3799000..3800916 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
PS033_RS18705 | 3801005..3802135 | + | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
PS033_RS18710 | 3802398..3803511 | - | 1114 | Protein_3649 | IS4-like element IS421 family transposase | - |
PS033_RS18715 | 3803589..3803741 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3803790..3803847 | + | 58 | - | - | Antitoxin |
PS033_RS18720 | 3804363..3805124 | + | 762 | WP_059267799.1 | outer membrane protein OmpK | - |
PS033_RS18725 | 3805145..3806638 | + | 1494 | Protein_3652 | sulfatase-like hydrolase/transferase | - |
PS033_RS18730 | 3806792..3808039 | + | 1248 | WP_059267798.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T272012 WP_000809168.1 NZ_CP117678:c3803741-3803589 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT272012 NZ_CP117678:3803790-3803847 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|