Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 2783532..2784244 | Replicon | chromosome |
Accession | NZ_CP117678 | ||
Organism | Escherichia albertii strain BIA_4 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
Locus tag | PS033_RS13975 | Protein ID | WP_000162413.1 |
Coordinates | 2783532..2783834 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS033_RS13980 | Protein ID | WP_000806446.1 |
Coordinates | 2783906..2784244 (+) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS033_RS13955 (2780395) | 2780395..2781237 | + | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
PS033_RS13960 (2781309) | 2781309..2782661 | + | 1353 | WP_054410173.1 | glutathione-disulfide reductase | - |
PS033_RS13965 (2782715) | 2782715..2782798 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
PS033_RS13970 (2782874) | 2782874..2783368 | - | 495 | WP_059267928.1 | hypothetical protein | - |
PS033_RS13975 (2783532) | 2783532..2783834 | + | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS033_RS13980 (2783906) | 2783906..2784244 | + | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
PS033_RS13985 (2784301) | 2784301..2784480 | + | 180 | WP_002460167.1 | hypothetical protein | - |
PS033_RS13990 (2784817) | 2784817..2785383 | + | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
PS033_RS13995 (2785530) | 2785530..2786060 | + | 531 | WP_059267927.1 | LuxR C-terminal-related transcriptional regulator | - |
PS033_RS14000 (2786132) | 2786132..2787160 | - | 1029 | WP_001110409.1 | hematinate-forming heme oxygenase ChuS | - |
PS033_RS14005 (2787209) | 2787209..2789191 | - | 1983 | WP_059220987.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T272011 WP_000162413.1 NZ_CP117678:2783532-2783834 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|