Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53745..53999 | Replicon | plasmid pKW21 |
| Accession | NZ_CP117673 | ||
| Organism | Escherichia coli strain KW21 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PSR34_RS23970 | Protein ID | WP_001312851.1 |
| Coordinates | 53850..53999 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 53745..53806 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSR34_RS23945 (50493) | 50493..51239 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| PSR34_RS23950 (51298) | 51298..52158 | + | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| PSR34_RS23955 (52261) | 52261..52821 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PSR34_RS23960 (52957) | 52957..53169 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PSR34_RS23965 (53415) | 53415..53489 | + | 75 | Protein_64 | endonuclease | - |
| - (53745) | 53745..53806 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (53745) | 53745..53806 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (53745) | 53745..53806 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (53745) | 53745..53806 | - | 62 | NuclAT_1 | - | Antitoxin |
| PSR34_RS23970 (53850) | 53850..53999 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| PSR34_RS23975 (54283) | 54283..54540 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PSR34_RS23980 (54557) | 54557..54808 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| PSR34_RS23985 (54799) | 54799..54846 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| PSR34_RS23990 (54839) | 54839..55321 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| PSR34_RS23995 (55314) | 55314..56171 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PSR34_RS24000 (57112) | 57112..57765 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| PSR34_RS24005 (57858) | 57858..58115 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| PSR34_RS24010 (58048) | 58048..58449 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / aph(3')-Ia / mph(A) / oqxA / oqxB / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaCTX-M-55 / fosA3 / dfrA14 / dfrA12 / aadA2 / sitABCD | iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB | 1..179817 | 179817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T272000 WP_001312851.1 NZ_CP117673:53850-53999 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT272000 NZ_CP117673:c53806-53745 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
