Detailed information of TA system TA271997

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 15401..15670
• Replicon: plasmid pKW21
• Accession: NZ_CP117673
• Organism: Escherichia coli strain KW21

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PSR34_RS23735
• Protein ID: WP_001372321.1
• Coordinates: 15545..15670 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	15401..15466 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PSR34_RS23680	10620..11591	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
PSR34_RS23685	12228..12397	+	170	Protein_8	hypothetical protein	-
PSR34_RS23690	12580..12660	-	81	Protein_9	hypothetical protein	-
PSR34_RS23695	12730..12936	+	207	WP_000275856.1	hypothetical protein	-
PSR34_RS23700	12962..13501	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
PSR34_RS23705	13569..13802	+	234	WP_000005987.1	DUF905 family protein	-
PSR34_RS23710	13830..14027	+	198	Protein_13	hypothetical protein	-
PSR34_RS23715	14082..14516	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PSR34_RS23720	14513..15275	+	763	Protein_15	plasmid SOS inhibition protein A	-
PSR34_RS23725	15244..15432	-	189	WP_001299721.1	hypothetical protein	-
-	15244..15468	+	225	NuclAT_0	-	-
-	15244..15468	+	225	NuclAT_0	-	-
-	15244..15468	+	225	NuclAT_0	-	-
-	15244..15468	+	225	NuclAT_0	-	-
-	15401..15466	-	66	-	-	Antitoxin
PSR34_RS23730	15454..15603	+	150	Protein_17	plasmid maintenance protein Mok	-
PSR34_RS23735	15545..15670	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PSR34_RS23740	15890..16120	+	231	WP_071586998.1	hypothetical protein	-
PSR34_RS23745	16118..16290	-	173	Protein_20	hypothetical protein	-
PSR34_RS23750	16360..16566	+	207	WP_000547968.1	hypothetical protein	-
PSR34_RS23755	16591..16878	+	288	WP_000107535.1	hypothetical protein	-
PSR34_RS23760	16996..17817	+	822	WP_001234426.1	DUF932 domain-containing protein	-
PSR34_RS23765	18114..18716	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
PSR34_RS23770	19037..19420	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PSR34_RS23775	19607..20296	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / aac(3)-IId / aph(3')-Ia / mph(A) / oqxA / oqxB / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaCTX-M-55 / fosA3 / dfrA14 / dfrA12 / aadA2 / sitABCD	iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB	1..179817	179817

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T271997 WP_001372321.1 NZ_CP117673:15545-15670 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT271997 NZ_CP117673:c15466-15401 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin