Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4653015..4653617 | Replicon | chromosome |
Accession | NZ_CP117672 | ||
Organism | Escherichia coli strain KW21 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | PSR34_RS22690 | Protein ID | WP_000897305.1 |
Coordinates | 4653306..4653617 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PSR34_RS22685 | Protein ID | WP_000356397.1 |
Coordinates | 4653015..4653305 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSR34_RS22660 (4648941) | 4648941..4649843 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PSR34_RS22665 (4649840) | 4649840..4650475 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PSR34_RS22670 (4650472) | 4650472..4651401 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
PSR34_RS22675 (4651731) | 4651731..4651973 | - | 243 | WP_001086388.1 | protein YiiF | - |
PSR34_RS22680 (4652192) | 4652192..4652410 | - | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
PSR34_RS22685 (4653015) | 4653015..4653305 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PSR34_RS22690 (4653306) | 4653306..4653617 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
PSR34_RS22695 (4653846) | 4653846..4654754 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
PSR34_RS22700 (4654818) | 4654818..4655759 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
PSR34_RS22705 (4655804) | 4655804..4656241 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PSR34_RS22710 (4656238) | 4656238..4657110 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PSR34_RS22715 (4657104) | 4657104..4657703 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T271995 WP_000897305.1 NZ_CP117672:c4653617-4653306 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|