Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4048773..4049467 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | PS054_RS19905 | Protein ID | WP_001263500.1 |
| Coordinates | 4049069..4049467 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PS054_RS19900 | Protein ID | WP_000554758.1 |
| Coordinates | 4048773..4049066 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS19880 (4044472) | 4044472..4044969 | + | 498 | WP_095573642.1 | REP-associated tyrosine transposase RayT | - |
| PS054_RS19885 (4045085) | 4045085..4046797 | - | 1713 | Protein_3872 | flagellar biosynthesis protein FlhA | - |
| PS054_RS19890 (4046769) | 4046769..4047536 | + | 768 | WP_072243690.1 | putative lateral flagellar export/assembly protein LafU | - |
| PS054_RS19895 (4047666) | 4047666..4048721 | + | 1056 | WP_059217800.1 | DNA polymerase IV | - |
| PS054_RS19900 (4048773) | 4048773..4049066 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PS054_RS19905 (4049069) | 4049069..4049467 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PS054_RS19910 (4049477) | 4049477..4049929 | + | 453 | WP_095575504.1 | GNAT family N-acetyltransferase | - |
| PS054_RS19915 (4049942) | 4049942..4050541 | + | 600 | WP_072249376.1 | peptide chain release factor H | - |
| PS054_RS19920 (4050557) | 4050557..4050679 | + | 123 | Protein_3879 | metal-dependent hydrolase | - |
| PS054_RS19925 (4050682) | 4050682..4050924 | - | 243 | WP_059222190.1 | hypothetical protein | - |
| PS054_RS19930 (4050983) | 4050983..4052440 | - | 1458 | WP_273814186.1 | cytosol nonspecific dipeptidase | - |
| PS054_RS19935 (4052701) | 4052701..4053159 | + | 459 | WP_001291989.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T271972 WP_001263500.1 NZ_CP117668:4049069-4049467 [Escherichia albertii]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|