Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-timR/SymE(toxin) |
| Location | 3732918..3733330 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | PS054_RS18410 | Protein ID | WP_124866422.1 |
| Coordinates | 3732918..3733259 (-) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | timR | ||
| Locus tag | - | ||
| Coordinates | 3733254..3733330 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS18390 (3728391) | 3728391..3728879 | + | 489 | Protein_3583 | Rpn family recombination-promoting nuclease/putative transposase | - |
| PS054_RS18395 (3729197) | 3729197..3730275 | + | 1079 | Protein_3584 | DUF1998 domain-containing protein | - |
| PS054_RS18400 (3730331) | 3730331..3731377 | - | 1047 | WP_072249344.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
| PS054_RS18405 (3731377) | 3731377..3732756 | - | 1380 | WP_124866423.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| PS054_RS18410 (3732918) | 3732918..3733259 | - | 342 | WP_124866422.1 | endoribonuclease SymE | Toxin |
| - (3733254) | 3733254..3733330 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (3733254) | 3733254..3733330 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (3733254) | 3733254..3733330 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (3733254) | 3733254..3733330 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (3733254) | 3733254..3733330 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (3733254) | 3733254..3733330 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (3733254) | 3733254..3733330 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (3733254) | 3733254..3733330 | + | 77 | NuclAT_9 | - | Antitoxin |
| PS054_RS18415 (3733487) | 3733487..3734836 | - | 1350 | WP_113649426.1 | restriction endonuclease subunit S | - |
| PS054_RS18420 (3734833) | 3734833..3736422 | - | 1590 | WP_113649427.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12338.18 Da Isoelectric Point: 8.4951
>T271966 WP_124866422.1 NZ_CP117668:c3733259-3732918 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFVTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVRDFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFVTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVRDFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271966 NZ_CP117668:3733254-3733330 [Escherichia albertii]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|