Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 2810434..2811146 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PS054_RS14135 | Protein ID | WP_113650514.1 |
| Coordinates | 2810434..2810736 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS054_RS14140 | Protein ID | WP_000806446.1 |
| Coordinates | 2810808..2811146 (+) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS14110 (2807097) | 2807097..2807939 | + | 843 | WP_113650511.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
| PS054_RS14115 (2808011) | 2808011..2809363 | + | 1353 | WP_113650512.1 | glutathione-disulfide reductase | - |
| PS054_RS14120 (2809417) | 2809417..2809500 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS054_RS14125 (2809528) | 2809528..2809701 | + | 174 | WP_000553433.1 | hypothetical protein | - |
| PS054_RS14130 (2809980) | 2809980..2810270 | - | 291 | WP_113650513.1 | hypothetical protein | - |
| PS054_RS14135 (2810434) | 2810434..2810736 | + | 303 | WP_113650514.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS054_RS14140 (2810808) | 2810808..2811146 | + | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| PS054_RS14145 (2811203) | 2811203..2811370 | + | 168 | WP_273813853.1 | hypothetical protein | - |
| PS054_RS14150 (2811719) | 2811719..2812285 | + | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| PS054_RS14155 (2812432) | 2812432..2812962 | + | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS054_RS14160 (2813034) | 2813034..2814062 | - | 1029 | WP_273813856.1 | hematinate-forming heme oxygenase ChuS | - |
| PS054_RS14165 (2814111) | 2814111..2816093 | - | 1983 | WP_059220987.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11870.60 Da Isoelectric Point: 10.0443
>T271964 WP_113650514.1 NZ_CP117668:2810434-2810736 [Escherichia albertii]
MTKKINIKNFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKNFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|