Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 580532..580757 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | PS054_RS03130 | Protein ID | WP_000813254.1 |
| Coordinates | 580602..580757 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 580532..580590 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS03095 | 576049..576795 | + | 747 | WP_113649859.1 | ATP-binding protein | - |
| PS054_RS03100 | 576818..577579 | + | 762 | WP_273814812.1 | DUF1627 domain-containing protein | - |
| PS054_RS03105 | 577587..578003 | + | 417 | WP_273814813.1 | DUF977 family protein | - |
| PS054_RS03110 | 578000..578254 | + | 255 | WP_273814815.1 | hypothetical protein | - |
| PS054_RS03115 | 578247..578558 | + | 312 | WP_273814816.1 | hypothetical protein | - |
| PS054_RS03120 | 578692..579246 | - | 555 | WP_024229929.1 | hypothetical protein | - |
| PS054_RS03125 | 579243..580175 | - | 933 | WP_273814817.1 | hypothetical protein | - |
| - | 580532..580590 | - | 59 | - | - | Antitoxin |
| PS054_RS03130 | 580602..580757 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| PS054_RS03135 | 581010..581087 | + | 78 | Protein_620 | hypothetical protein | - |
| PS054_RS03140 | 581243..581842 | + | 600 | WP_273814820.1 | DUF1367 family protein | - |
| PS054_RS03145 | 581842..582132 | + | 291 | WP_000228020.1 | DUF1364 domain-containing protein | - |
| PS054_RS03150 | 582129..582671 | + | 543 | WP_048969771.1 | DUF1133 family protein | - |
| PS054_RS03155 | 583169..583504 | + | 336 | WP_273814822.1 | phage holin, lambda family | - |
| PS054_RS03160 | 583508..583984 | + | 477 | WP_001194114.1 | glycoside hydrolase family protein | - |
| PS054_RS03165 | 583968..584360 | + | 393 | WP_059214839.1 | DUF2570 domain-containing protein | - |
| PS054_RS03170 | 584245..584523 | + | 279 | WP_233991579.1 | hypothetical protein | - |
| PS054_RS03175 | 584568..584690 | + | 123 | WP_262410196.1 | hypothetical protein | - |
| PS054_RS03180 | 584809..585066 | + | 258 | Protein_629 | ParB/Srx family N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 565395..609143 | 43748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T271952 WP_000813254.1 NZ_CP117668:580602-580757 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271952 NZ_CP117668:c580590-580532 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|