Detailed information of TA system TA271952

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 580532..580757
• Replicon: chromosome
• Accession: NZ_CP117668
• Organism: Escherichia albertii strain BIA_11

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: S1ELB5
• Locus tag: PS054_RS03130
• Protein ID: WP_000813254.1
• Coordinates: 580602..580757 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	580532..580590 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS054_RS03095	576049..576795	+	747	WP_113649859.1	ATP-binding protein	-
PS054_RS03100	576818..577579	+	762	WP_273814812.1	DUF1627 domain-containing protein	-
PS054_RS03105	577587..578003	+	417	WP_273814813.1	DUF977 family protein	-
PS054_RS03110	578000..578254	+	255	WP_273814815.1	hypothetical protein	-
PS054_RS03115	578247..578558	+	312	WP_273814816.1	hypothetical protein	-
PS054_RS03120	578692..579246	-	555	WP_024229929.1	hypothetical protein	-
PS054_RS03125	579243..580175	-	933	WP_273814817.1	hypothetical protein	-
-	580532..580590	-	59	-	-	Antitoxin
PS054_RS03130	580602..580757	+	156	WP_000813254.1	type I toxin-antitoxin system toxin HokD	Toxin
PS054_RS03135	581010..581087	+	78	Protein_620	hypothetical protein	-
PS054_RS03140	581243..581842	+	600	WP_273814820.1	DUF1367 family protein	-
PS054_RS03145	581842..582132	+	291	WP_000228020.1	DUF1364 domain-containing protein	-
PS054_RS03150	582129..582671	+	543	WP_048969771.1	DUF1133 family protein	-
PS054_RS03155	583169..583504	+	336	WP_273814822.1	phage holin, lambda family	-
PS054_RS03160	583508..583984	+	477	WP_001194114.1	glycoside hydrolase family protein	-
PS054_RS03165	583968..584360	+	393	WP_059214839.1	DUF2570 domain-containing protein	-
PS054_RS03170	584245..584523	+	279	WP_233991579.1	hypothetical protein	-
PS054_RS03175	584568..584690	+	123	WP_262410196.1	hypothetical protein	-
PS054_RS03180	584809..585066	+	258	Protein_629	ParB/Srx family N-terminal domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	565395..609143	43748

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5736.89 Da
• Isoelectric Point: 6.1531

>T271952 WP_000813254.1 NZ_CP117668:580602-580757 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271952 NZ_CP117668:c580590-580532 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Structures

Toxin

• AlphaFold DB: A0A4P7TMW0

Antitoxin