Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 566952..567322 | Replicon | chromosome |
Accession | NZ_CP117668 | ||
Organism | Escherichia albertii strain BIA_11 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | - |
Locus tag | PS054_RS03030 | Protein ID | WP_273814798.1 |
Coordinates | 567128..567322 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 566952..567129 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS054_RS03000 (562728) | 562728..562901 | + | 174 | WP_032275239.1 | protein YnaL | - |
PS054_RS03005 (562931) | 562931..564304 | + | 1374 | WP_059268187.1 | ATP-dependent RNA helicase DbpA | - |
PS054_RS03010 (564408) | 564408..565343 | - | 936 | WP_044712357.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
PS054_RS03015 (565395) | 565395..566630 | - | 1236 | WP_059221776.1 | site-specific integrase | - |
PS054_RS03020 (566632) | 566632..566847 | - | 216 | WP_048969784.1 | excisionase XisR | - |
- (566952) | 566952..567129 | + | 178 | NuclAT_0 | - | Antitoxin |
- (566952) | 566952..567129 | + | 178 | NuclAT_0 | - | Antitoxin |
- (566952) | 566952..567129 | + | 178 | NuclAT_0 | - | Antitoxin |
- (566952) | 566952..567129 | + | 178 | NuclAT_0 | - | Antitoxin |
PS054_RS03025 (566947) | 566947..567135 | - | 189 | WP_273814796.1 | DUF1187 family protein | - |
PS054_RS03030 (567128) | 567128..567322 | - | 195 | WP_273814798.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
PS054_RS03035 (567387) | 567387..568439 | - | 1053 | WP_273814800.1 | RecT family recombinase | - |
PS054_RS03040 (568451) | 568451..571612 | - | 3162 | WP_273814803.1 | exodeoxyribonuclease VIII | - |
PS054_RS03045 (571713) | 571713..571987 | - | 275 | Protein_602 | hypothetical protein | - |
PS054_RS03050 (572062) | 572062..572232 | - | 171 | WP_273814805.1 | YdaE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 565395..609143 | 43748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7114.11 Da Isoelectric Point: 8.9276
>T271949 WP_273814798.1 NZ_CP117668:c567322-567128 [Escherichia albertii]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSDKEALERWNKRTAENINGGIYV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSDKEALERWNKRTAENINGGIYV
Download Length: 195 bp
Antitoxin
Download Length: 178 bp
>AT271949 NZ_CP117668:566952-567129 [Escherichia albertii]
AGGAATGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACTTTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCACCTTCCTTTTC
AATTGTGGCGGTAATTTT
AGGAATGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACTTTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCACCTTCCTTTTC
AATTGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|