Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 516130..516355 Replicon chromosome
Accession NZ_CP117668
Organism Escherichia albertii strain BIA_11

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag PS054_RS02710 Protein ID WP_000813254.1
Coordinates 516200..516355 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 516130..516188 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS054_RS02665 511566..511667 - 102 Protein_526 protein YdfB -
PS054_RS02670 511669..511824 - 156 WP_021526337.1 DUF1391 family protein -
PS054_RS02675 511991..512398 - 408 WP_038354783.1 DNA-binding transcriptional dual regulator DicA -
PS054_RS02680 512482..512712 + 231 WP_273814734.1 dicB transcriptional regulator DicC -
PS054_RS02685 512696..513217 + 522 WP_273814736.1 toxin YdaT family protein -
PS054_RS02690 513198..514175 + 978 WP_273814739.1 hypothetical protein -
PS054_RS02695 514216..514638 + 423 WP_001151183.1 DUF977 family protein -
PS054_RS02700 514635..514811 + 177 Protein_533 methyltransferase -
PS054_RS02705 514922..515587 + 666 WP_001595803.1 epoxyqueuosine reductase QueH -
- 516130..516188 - 59 - - Antitoxin
PS054_RS02710 516200..516355 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
PS054_RS02715 516572..516823 + 252 WP_000980999.1 protein Rem -
PS054_RS02720 516890..517168 + 279 WP_023147795.1 hypothetical protein -
PS054_RS02725 517170..518219 + 1050 WP_001265275.1 DUF968 domain-containing protein -
PS054_RS02730 518233..518985 + 753 WP_273814744.1 antitermination protein -
PS054_RS02735 520146..520331 - 186 WP_000203370.1 hypothetical protein -
PS054_RS02740 520957..521046 - 90 WP_120795389.1 hypothetical protein -
PS054_RS02745 521101..521313 - 213 WP_000087756.1 cold shock-like protein CspF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 506068..550506 44438


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T271948 WP_000813254.1 NZ_CP117668:516200-516355 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271948 NZ_CP117668:c516188-516130 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References