Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 4614976..4615578 Replicon chromosome
Accession NZ_CP117659
Organism Escherichia albertii strain BIA_13

Toxin (Protein)


Gene name higB Uniprot ID S1P416
Locus tag PS034_RS22480 Protein ID WP_000897302.1
Coordinates 4615267..4615578 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PS034_RS22475 Protein ID WP_000356397.1
Coordinates 4614976..4615266 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS034_RS22435 (4610381) 4610381..4611283 + 903 WP_000331386.1 formate dehydrogenase O subunit beta -
PS034_RS22440 (4611280) 4611280..4611915 + 636 WP_000829019.1 formate dehydrogenase cytochrome b556 subunit -
PS034_RS22445 (4611912) 4611912..4612841 + 930 WP_000027704.1 formate dehydrogenase accessory protein FdhE -
PS034_RS22450 (4612878) 4612878..4613252 - 375 WP_107192776.1 type II toxin-antitoxin system VapC family toxin -
PS034_RS22455 (4613252) 4613252..4613494 - 243 WP_103054107.1 CopG family transcriptional regulator -
PS034_RS22460 (4613722) 4613722..4613940 - 219 WP_001314326.1 CopG family transcriptional regulator -
PS034_RS22465 (4614339) 4614339..4614617 - 279 WP_032278934.1 hypothetical protein -
PS034_RS22470 (4614679) 4614679..4614891 - 213 WP_000197774.1 hypothetical protein -
PS034_RS22475 (4614976) 4614976..4615266 - 291 WP_000356397.1 NadS family protein Antitoxin
PS034_RS22480 (4615267) 4615267..4615578 - 312 WP_000897302.1 hypothetical protein Toxin
PS034_RS22485 (4615807) 4615807..4616715 + 909 WP_273822320.1 alpha/beta hydrolase -
PS034_RS22490 (4616779) 4616779..4617720 - 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
PS034_RS22495 (4617765) 4617765..4618202 - 438 WP_000560979.1 D-aminoacyl-tRNA deacylase -
PS034_RS22500 (4618199) 4618199..4619071 - 873 WP_000916663.1 virulence factor BrkB family protein -
PS034_RS22505 (4619065) 4619065..4619664 - 600 WP_002460585.1 glucose-1-phosphatase -
PS034_RS22510 (4619763) 4619763..4620548 - 786 WP_000059671.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-85)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12203.19 Da        Isoelectric Point: 9.7791

>T271939 WP_000897302.1 NZ_CP117659:c4615578-4615267 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW

Download         Length: 312 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10846.43 Da        Isoelectric Point: 10.8907

>AT271939 WP_000356397.1 NZ_CP117659:c4615266-4614976 [Escherichia albertii]
MDKALFERLTHSMAQMNEIIEGTRQPSRTFEVDAMKIKEIRRASGLSQSKFADLISVSVDTLRNWEQGRRSPTGPAKALL
RAIANDPQHVLQALNR

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1P416

Antitoxin

Source ID Structure

References