Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 16764..17410 Replicon plasmid pEA15_3
Accession NZ_CP117657
Organism Escherichia albertii strain BIA_15

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PS036_RS25090 Protein ID WP_069915522.1
Coordinates 16764..17111 (+) Length 116 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A1V3UZT0
Locus tag PS036_RS25095 Protein ID WP_001259436.1
Coordinates 17111..17410 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS036_RS25060 (PS036_25060) 12078..12605 - 528 WP_000972114.1 tail fiber assembly protein -
PS036_RS25065 (PS036_25065) 12607..13449 - 843 WP_024133807.1 tail fiber protein -
PS036_RS25070 (PS036_25070) 13585..14139 + 555 WP_001199265.1 recombinase family protein -
PS036_RS25075 (PS036_25075) 14321..15301 + 981 WP_231367435.1 plasmid replication initiator RepA -
PS036_RS25080 (PS036_25080) 15945..16232 + 288 WP_000356589.1 hypothetical protein -
PS036_RS25085 (PS036_25085) 16256..16519 + 264 WP_000424604.1 hypothetical protein -
PS036_RS25090 (PS036_25090) 16764..17111 + 348 WP_069915522.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS036_RS25095 (PS036_25095) 17111..17410 + 300 WP_001259436.1 XRE family transcriptional regulator Antitoxin
PS036_RS25100 (PS036_25100) 17574..17954 + 381 WP_000061763.1 hypothetical protein -
PS036_RS25105 (PS036_25105) 18018..18290 + 273 WP_042038402.1 helix-turn-helix domain-containing protein -
PS036_RS25110 (PS036_25110) 18901..19089 + 189 WP_273811354.1 hypothetical protein -
PS036_RS25115 (PS036_25115) 19100..19726 - 627 WP_235179883.1 Rha family transcriptional regulator -
PS036_RS25120 (PS036_25120) 19895..20242 - 348 Protein_25 ORF6N domain-containing protein -
PS036_RS25125 (PS036_25125) 20239..20430 - 192 WP_042038396.1 hypothetical protein -
PS036_RS25130 (PS036_25130) 20544..20699 - 156 Protein_27 ash family protein -
PS036_RS25135 (PS036_25135) 20880..21452 + 573 WP_047661062.1 helix-turn-helix domain-containing protein -
PS036_RS25140 (PS036_25140) 22012..22161 - 150 WP_000003575.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..51282 51282


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-105)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-80)


Sequences

Toxin        


Download         Length: 116 a.a.        Molecular weight: 13560.48 Da        Isoelectric Point: 8.8337

>T271917 WP_069915522.1 NZ_CP117657:16764-17111 [Escherichia albertii]
MWTVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKQVRIAEDEFAAHLNTLESK

Download         Length: 348 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11074.92 Da        Isoelectric Point: 5.2090

>AT271917 WP_001259436.1 NZ_CP117657:17111-17410 [Escherichia albertii]
MRTLDEVIASRSPESQARIKEMADEMILEVGLQMMREELQLSQKQVAEAMGISQPAVTKLEQRGNDLKLATLKRYVEAMG
GKLSLDVELPTGKRIAFNI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1V3UZT0

References