Detailed information of TA system TA271913

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 111814..112240
• Replicon: plasmid pEA15_1
• Accession: NZ_CP117655
• Organism: Escherichia albertii strain BIA_15

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PS036_RS24345
• Protein ID: WP_001372321.1
• Coordinates: 111814..111939 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	112016..112240 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS036_RS24300 (106869)	106869..107096	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
PS036_RS24305 (107190)	107190..107876	-	687	WP_000332484.1	PAS domain-containing protein	-
PS036_RS24310 (108067)	108067..108450	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PS036_RS24315 (108780)	108780..109379	+	600	WP_273811152.1	transglycosylase SLT domain-containing protein	-
PS036_RS24320 (109676)	109676..110497	-	822	WP_273811154.1	DUF932 domain-containing protein	-
PS036_RS24325 (110617)	110617..110904	-	288	WP_000107535.1	hypothetical protein	-
PS036_RS24330 (110929)	110929..111135	-	207	WP_000547968.1	hypothetical protein	-
PS036_RS24335 (111205)	111205..111364	+	160	Protein_123	hypothetical protein	-
PS036_RS24340 (111362)	111362..111592	-	231	WP_262933420.1	hypothetical protein	-
PS036_RS24345 (111814)	111814..111939	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PS036_RS24350 (111881)	111881..112030	-	150	Protein_126	plasmid maintenance protein Mok	-
- (112016)	112016..112240	-	225	NuclAT_0	-	Antitoxin
- (112016)	112016..112240	-	225	NuclAT_0	-	Antitoxin
- (112016)	112016..112240	-	225	NuclAT_0	-	Antitoxin
- (112016)	112016..112240	-	225	NuclAT_0	-	Antitoxin
PS036_RS24355 (112052)	112052..112240	+	189	WP_001299721.1	hypothetical protein	-
PS036_RS24360 (112209)	112209..112971	-	763	Protein_128	plasmid SOS inhibition protein A	-
PS036_RS24365 (112968)	112968..113402	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PS036_RS24370 (113457)	113457..115415	-	1959	WP_273811158.1	ParB/RepB/Spo0J family partition protein	-
PS036_RS24375 (115481)	115481..115714	-	234	WP_000005990.1	DUF905 family protein	-
PS036_RS24380 (115777)	115777..116316	-	540	WP_000290838.1	single-stranded DNA-binding protein	-
PS036_RS24385 (116342)	116342..116548	-	207	WP_000275858.1	hypothetical protein	-
PS036_RS24390 (116789)	116789..117031	-	243	WP_072148829.1	hypothetical protein	-
PS036_RS24395 (116959)	116959..117156	-	198	WP_001430256.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	espL2 / espL2 / vat	1..130064	130064

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T271913 WP_001372321.1 NZ_CP117655:c111939-111814 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT271913 NZ_CP117655:c112240-112016 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin