Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67988..68242 | Replicon | plasmid pEA15_1 |
| Accession | NZ_CP117655 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | PS036_RS24065 | Protein ID | WP_001336447.1 |
| Coordinates | 67988..68137 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 68181..68242 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS24030 (63721) | 63721..64002 | - | 282 | WP_000780222.1 | helix-turn-helix transcriptional regulator | - |
| PS036_RS24035 (63983) | 63983..64312 | - | 330 | WP_059236325.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PS036_RS24040 (65252) | 65252..66109 | - | 858 | WP_137648027.1 | incFII family plasmid replication initiator RepA | - |
| PS036_RS24045 (66102) | 66102..66176 | - | 75 | WP_001367777.1 | RepA leader peptide Tap | - |
| PS036_RS24050 (66408) | 66408..66665 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PS036_RS24055 (66975) | 66975..67457 | - | 483 | WP_000405244.1 | GNAT family N-acetyltransferase | - |
| PS036_RS24060 (67448) | 67448..67750 | - | 303 | WP_076741381.1 | DUF1778 domain-containing protein | - |
| PS036_RS24065 (67988) | 67988..68137 | - | 150 | WP_001336447.1 | Hok/Gef family protein | Toxin |
| - (68181) | 68181..68242 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68181) | 68181..68242 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68181) | 68181..68242 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68181) | 68181..68242 | + | 62 | NuclAT_1 | - | Antitoxin |
| PS036_RS24070 (68417) | 68417..68656 | - | 240 | Protein_70 | DUF2726 domain-containing protein | - |
| PS036_RS24075 (68707) | 68707..69384 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| PS036_RS24080 (69384) | 69384..69731 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS036_RS24085 (69751) | 69751..71322 | + | 1572 | WP_273810715.1 | IS66 family transposase | - |
| PS036_RS24090 (71352) | 71352..71504 | - | 153 | Protein_74 | hypothetical protein | - |
| PS036_RS24095 (71698) | 71698..71910 | - | 213 | WP_059278122.1 | hypothetical protein | - |
| PS036_RS24100 (72046) | 72046..72606 | - | 561 | WP_258146168.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 / espL2 / vat | 1..130064 | 130064 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T271908 WP_001336447.1 NZ_CP117655:c68137-67988 [Escherichia albertii]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT271908 NZ_CP117655:68181-68242 [Escherichia albertii]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|