Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3974211..3974469 | Replicon | chromosome |
| Accession | NZ_CP117654 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PS036_RS19835 | Protein ID | WP_000809168.1 |
| Coordinates | 3974317..3974469 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3974211..3974268 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS19820 | 3970219..3971447 | + | 1229 | WP_089541817.1 | IS3 family transposase | - |
| PS036_RS19825 | 3971372..3972913 | - | 1542 | WP_273810779.1 | sulfatase-like hydrolase/transferase | - |
| PS036_RS19830 | 3972934..3973695 | - | 762 | WP_059275866.1 | outer membrane protein OmpK | - |
| - | 3974211..3974268 | - | 58 | - | - | Antitoxin |
| PS036_RS19835 | 3974317..3974469 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| PS036_RS19840 | 3974547..3975658 | + | 1112 | Protein_3873 | IS4-like element IS421 family transposase | - |
| PS036_RS19845 | 3975921..3977051 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS036_RS19850 | 3977140..3979056 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 3970219..3975821 | 5602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271904 WP_000809168.1 NZ_CP117654:3974317-3974469 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271904 NZ_CP117654:c3974268-3974211 [Escherichia albertii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|