Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3715296..3715990 | Replicon | chromosome |
Accession | NZ_CP117654 | ||
Organism | Escherichia albertii strain BIA_15 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | PS036_RS18570 | Protein ID | WP_001263500.1 |
Coordinates | 3715296..3715694 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PS036_RS18575 | Protein ID | WP_000554758.1 |
Coordinates | 3715697..3715990 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS036_RS18540 (3711604) | 3711604..3712062 | - | 459 | WP_273810775.1 | xanthine phosphoribosyltransferase | - |
PS036_RS18545 (3712323) | 3712323..3713780 | + | 1458 | WP_001292996.1 | cytosol nonspecific dipeptidase | - |
PS036_RS18550 (3713839) | 3713839..3714081 | + | 243 | WP_059222190.1 | hypothetical protein | - |
PS036_RS18555 (3714084) | 3714084..3714206 | - | 123 | Protein_3623 | metal-dependent hydrolase | - |
PS036_RS18560 (3714222) | 3714222..3714821 | - | 600 | WP_072248949.1 | peptide chain release factor H | - |
PS036_RS18565 (3714834) | 3714834..3715286 | - | 453 | WP_072243685.1 | GNAT family N-acetyltransferase | - |
PS036_RS18570 (3715296) | 3715296..3715694 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PS036_RS18575 (3715697) | 3715697..3715990 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PS036_RS18580 (3716042) | 3716042..3717097 | - | 1056 | WP_059217800.1 | DNA polymerase IV | - |
PS036_RS18585 (3717227) | 3717227..3717994 | - | 768 | WP_072243690.1 | putative lateral flagellar export/assembly protein LafU | - |
PS036_RS18590 (3717966) | 3717966..3719678 | + | 1713 | Protein_3630 | flagellar biosynthesis protein FlhA | - |
PS036_RS18595 (3719794) | 3719794..3720291 | - | 498 | WP_059275984.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | gmhA/lpcA / IlpA | 3714834..3753240 | 38406 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T271903 WP_001263500.1 NZ_CP117654:c3715694-3715296 [Escherichia albertii]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|