Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2784575..2784800 Replicon chromosome
Accession NZ_CP117654
Organism Escherichia albertii strain BIA_15

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag PS036_RS13945 Protein ID WP_000813254.1
Coordinates 2784575..2784730 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2784742..2784800 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS036_RS13900 2779890..2780075 - 186 WP_032193450.1 Rz1 family lipoprotein -
PS036_RS13905 2780292..2780789 - 498 WP_273810738.1 lysozyme RrrD -
PS036_RS13910 2780789..2781004 - 216 WP_000839574.1 class II holin family protein -
PS036_RS13925 2781729..2782418 - 690 WP_204629327.1 bacteriophage antitermination protein Q -
PS036_RS13930 2782415..2782780 - 366 WP_054413016.1 RusA family crossover junction endodeoxyribonuclease -
PS036_RS13935 2782781..2783836 - 1056 WP_273810739.1 DUF968 domain-containing protein -
PS036_RS13940 2783838..2784116 - 279 WP_001429486.1 hypothetical protein -
PS036_RS13945 2784575..2784730 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2784742..2784800 + 59 - - Antitoxin
PS036_RS13950 2785526..2786860 + 1335 WP_273810740.1 FRG domain-containing protein -
PS036_RS13955 2787099..2787521 - 423 WP_273810741.1 DUF977 family protein -
PS036_RS13960 2787562..2788632 - 1071 WP_273810742.1 phage replisome organizer -
PS036_RS13965 2788704..2789129 - 426 WP_062863952.1 toxin YdaT family protein -
PS036_RS13970 2789113..2789385 - 273 WP_069722730.1 YdaS family helix-turn-helix protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - cif / nleH1 2752167..2803306 51139
- inside Prophage - cif / nleH1 2750920..2803306 52386


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T271899 WP_000813254.1 NZ_CP117654:c2784730-2784575 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271899 NZ_CP117654:2784742-2784800 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References