Detailed information of TA system TA271897

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2616483..2616708
• Replicon: chromosome
• Accession: NZ_CP117654
• Organism: Escherichia albertii strain BIA_15

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: A0A8H9SPE4
• Locus tag: PS036_RS13040
• Protein ID: WP_001406737.1
• Coordinates: 2616483..2616638 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2616650..2616708 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS036_RS12990	2611751..2611966	-	216	WP_000839596.1	phage lysis protein EssD	-
PS036_RS12995	2612681..2613244	+	564	WP_024246368.1	DUF1440 domain-containing protein	-
PS036_RS13020	2613928..2614617	-	690	WP_059222310.1	bacteriophage antitermination protein Q	-
PS036_RS13025	2614614..2614979	-	366	WP_054413016.1	RusA family crossover junction endodeoxyribonuclease	-
PS036_RS13030	2614980..2616035	-	1056	WP_273810723.1	DUF968 domain-containing protein	-
PS036_RS13035	2616037..2616315	-	279	WP_059225803.1	hypothetical protein	-
PS036_RS13040	2616483..2616638	-	156	WP_001406737.1	type I toxin-antitoxin system toxin HokD	Toxin
-	2616650..2616708	+	59	-	-	Antitoxin
PS036_RS13045	2616850..2616978	-	129	WP_256876870.1	hypothetical protein	-
PS036_RS13050	2617047..2617184	-	138	WP_187642122.1	hypothetical protein	-
PS036_RS13055	2617189..2617386	-	198	Protein_2552	DUF551 domain-containing protein	-
PS036_RS13060	2617533..2617940	-	408	WP_059259431.1	hypothetical protein	-
PS036_RS13065	2618099..2618515	-	417	WP_273810724.1	DUF977 family protein	-
PS036_RS13070	2618523..2619285	-	763	Protein_2555	DUF1627 domain-containing protein	-
PS036_RS13075	2619309..2620055	-	747	WP_149454758.1	ATP-binding protein	-
PS036_RS13080	2620062..2621027	-	966	WP_059245561.1	hypothetical protein	-
PS036_RS13085	2621008..2621529	-	522	WP_273810725.1	toxin YdaT family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2585577..2633856	48279
	-	inside	Prophage	-	-	2585577..2630108	44531

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5794.93 Da
• Isoelectric Point: 4.8535

>T271897 WP_001406737.1 NZ_CP117654:c2616638-2616483 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271897 NZ_CP117654:2616650-2616708 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Structures

Antitoxin