Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2616483..2616708 | Replicon | chromosome |
| Accession | NZ_CP117654 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A8H9SPE4 |
| Locus tag | PS036_RS13040 | Protein ID | WP_001406737.1 |
| Coordinates | 2616483..2616638 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2616650..2616708 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS12990 | 2611751..2611966 | - | 216 | WP_000839596.1 | phage lysis protein EssD | - |
| PS036_RS12995 | 2612681..2613244 | + | 564 | WP_024246368.1 | DUF1440 domain-containing protein | - |
| PS036_RS13020 | 2613928..2614617 | - | 690 | WP_059222310.1 | bacteriophage antitermination protein Q | - |
| PS036_RS13025 | 2614614..2614979 | - | 366 | WP_054413016.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PS036_RS13030 | 2614980..2616035 | - | 1056 | WP_273810723.1 | DUF968 domain-containing protein | - |
| PS036_RS13035 | 2616037..2616315 | - | 279 | WP_059225803.1 | hypothetical protein | - |
| PS036_RS13040 | 2616483..2616638 | - | 156 | WP_001406737.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2616650..2616708 | + | 59 | - | - | Antitoxin |
| PS036_RS13045 | 2616850..2616978 | - | 129 | WP_256876870.1 | hypothetical protein | - |
| PS036_RS13050 | 2617047..2617184 | - | 138 | WP_187642122.1 | hypothetical protein | - |
| PS036_RS13055 | 2617189..2617386 | - | 198 | Protein_2552 | DUF551 domain-containing protein | - |
| PS036_RS13060 | 2617533..2617940 | - | 408 | WP_059259431.1 | hypothetical protein | - |
| PS036_RS13065 | 2618099..2618515 | - | 417 | WP_273810724.1 | DUF977 family protein | - |
| PS036_RS13070 | 2618523..2619285 | - | 763 | Protein_2555 | DUF1627 domain-containing protein | - |
| PS036_RS13075 | 2619309..2620055 | - | 747 | WP_149454758.1 | ATP-binding protein | - |
| PS036_RS13080 | 2620062..2621027 | - | 966 | WP_059245561.1 | hypothetical protein | - |
| PS036_RS13085 | 2621008..2621529 | - | 522 | WP_273810725.1 | toxin YdaT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2585577..2633856 | 48279 | |
| - | inside | Prophage | - | - | 2585577..2630108 | 44531 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5794.93 Da Isoelectric Point: 4.8535
>T271897 WP_001406737.1 NZ_CP117654:c2616638-2616483 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271897 NZ_CP117654:2616650-2616708 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|