Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 233726..234438 | Replicon | chromosome |
| Accession | NZ_CP117654 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
| Locus tag | PS036_RS01060 | Protein ID | WP_000162413.1 |
| Coordinates | 234136..234438 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS036_RS01055 | Protein ID | WP_000806446.1 |
| Coordinates | 233726..234064 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS01030 (228779) | 228779..230761 | + | 1983 | WP_059275469.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
| PS036_RS01035 (230810) | 230810..231838 | + | 1029 | WP_001110409.1 | hematinate-forming heme oxygenase ChuS | - |
| PS036_RS01040 (231910) | 231910..232440 | - | 531 | WP_059275470.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS036_RS01045 (232587) | 232587..233153 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| PS036_RS01050 (233490) | 233490..233669 | - | 180 | WP_002460167.1 | hypothetical protein | - |
| PS036_RS01055 (233726) | 233726..234064 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| PS036_RS01060 (234136) | 234136..234438 | - | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS036_RS01065 (234602) | 234602..235096 | + | 495 | WP_059267928.1 | hypothetical protein | - |
| PS036_RS01070 (235172) | 235172..235255 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS036_RS01075 (235309) | 235309..236661 | - | 1353 | WP_054410173.1 | glutathione-disulfide reductase | - |
| PS036_RS01080 (236733) | 236733..237575 | - | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
| PS036_RS01085 (237756) | 237756..238766 | + | 1011 | WP_059275471.1 | YwqG family protein | - |
| PS036_RS01090 (238776) | 238776..239237 | - | 462 | WP_105632917.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T271888 WP_000162413.1 NZ_CP117654:c234438-234136 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|