Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 159208..159465 Replicon chromosome
Accession NZ_CP117654
Organism Escherichia albertii strain BIA_15

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS036_RS00730 Protein ID WP_001135738.1
Coordinates 159313..159465 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 159208..159256 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS036_RS00710 154438..155433 - 996 WP_059221277.1 acyltransferase -
PS036_RS00715 155606..155905 + 300 WP_000979961.1 YsaB family lipoprotein -
PS036_RS00720 156001..156912 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS036_RS00725 156922..158991 + 2070 WP_059275644.1 glycine--tRNA ligase subunit beta -
- 159208..159256 - 49 - - Antitoxin
PS036_RS00730 159313..159465 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
PS036_RS00735 159442..159513 - 72 WP_212734940.1 hypothetical protein -
PS036_RS00740 159653..159865 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS036_RS00745 160149..160439 - 291 WP_059221281.1 HTH-type transcriptional regulator -
PS036_RS00750 160862..161572 + 711 WP_002460072.1 DUF3053 domain-containing protein -
PS036_RS00755 161625..162599 - 975 WP_059221283.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS036_RS00760 162703..163362 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271887 WP_001135738.1 NZ_CP117654:159313-159465 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 49 bp

>AT271887 NZ_CP117654:c159256-159208 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References