Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3948404..3949098 | Replicon | chromosome |
| Accession | NZ_CP117650 | ||
| Organism | Escherichia albertii strain BIA_16-1 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | PS055_RS19090 | Protein ID | WP_001263500.1 |
| Coordinates | 3948700..3949098 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PS055_RS19085 | Protein ID | WP_000554758.1 |
| Coordinates | 3948404..3948697 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS055_RS19065 (3944103) | 3944103..3944600 | + | 498 | WP_059222192.1 | transposase | - |
| PS055_RS19070 (3944716) | 3944716..3946428 | - | 1713 | Protein_3710 | flagellar biosynthesis protein FlhA | - |
| PS055_RS19075 (3946400) | 3946400..3947167 | + | 768 | WP_072243690.1 | putative lateral flagellar export/assembly protein LafU | - |
| PS055_RS19080 (3947297) | 3947297..3948352 | + | 1056 | WP_059217800.1 | DNA polymerase IV | - |
| PS055_RS19085 (3948404) | 3948404..3948697 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PS055_RS19090 (3948700) | 3948700..3949098 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PS055_RS19095 (3949108) | 3949108..3949560 | + | 453 | WP_072243685.1 | GNAT family N-acetyltransferase | - |
| PS055_RS19100 (3949573) | 3949573..3950172 | + | 600 | WP_072243684.1 | peptide chain release factor H | - |
| PS055_RS19105 (3950188) | 3950188..3950310 | + | 123 | Protein_3717 | metal-dependent hydrolase | - |
| PS055_RS19110 (3950313) | 3950313..3950555 | - | 243 | WP_059222190.1 | hypothetical protein | - |
| PS055_RS19115 (3950614) | 3950614..3952071 | - | 1458 | WP_001292996.1 | cytosol nonspecific dipeptidase | - |
| PS055_RS19120 (3952332) | 3952332..3952790 | + | 459 | WP_001291989.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T271883 WP_001263500.1 NZ_CP117650:3948700-3949098 [Escherichia albertii]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|