Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1354495..1354716 Replicon chromosome
Accession NC_017626
Organism Escherichia coli 042

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag EC042_RS30035 Protein ID WP_014639145.1
Coordinates 1354495..1354602 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1354650..1354716 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC042_RS06660 1350339..1351421 + 1083 WP_000804726.1 peptide chain release factor 1 -
EC042_RS06665 1351421..1352254 + 834 WP_000456447.1 peptide chain release factor N(5)-glutamine methyltransferase -
EC042_RS06670 1352251..1352643 + 393 WP_000200387.1 invasion regulator SirB2 -
EC042_RS06675 1352647..1353456 + 810 WP_001257044.1 invasion regulator SirB1 -
EC042_RS06680 1353492..1354346 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
EC042_RS30035 1354495..1354602 - 108 WP_014639145.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1354650..1354716 + 67 NuclAT_14 - Antitoxin
- 1354650..1354716 + 67 NuclAT_14 - Antitoxin
- 1354650..1354716 + 67 NuclAT_14 - Antitoxin
- 1354650..1354716 + 67 NuclAT_14 - Antitoxin
- 1354650..1354716 + 67 NuclAT_16 - Antitoxin
- 1354650..1354716 + 67 NuclAT_16 - Antitoxin
- 1354650..1354716 + 67 NuclAT_16 - Antitoxin
- 1354650..1354716 + 67 NuclAT_16 - Antitoxin
- 1354650..1354716 + 67 NuclAT_18 - Antitoxin
- 1354650..1354716 + 67 NuclAT_18 - Antitoxin
- 1354650..1354716 + 67 NuclAT_18 - Antitoxin
- 1354650..1354716 + 67 NuclAT_18 - Antitoxin
- 1354650..1354716 + 67 NuclAT_20 - Antitoxin
- 1354650..1354716 + 67 NuclAT_20 - Antitoxin
- 1354650..1354716 + 67 NuclAT_20 - Antitoxin
- 1354650..1354716 + 67 NuclAT_20 - Antitoxin
- 1354650..1354716 + 67 NuclAT_22 - Antitoxin
- 1354650..1354716 + 67 NuclAT_22 - Antitoxin
- 1354650..1354716 + 67 NuclAT_22 - Antitoxin
- 1354650..1354716 + 67 NuclAT_22 - Antitoxin
- 1354650..1354716 + 67 NuclAT_24 - Antitoxin
- 1354650..1354716 + 67 NuclAT_24 - Antitoxin
- 1354650..1354716 + 67 NuclAT_24 - Antitoxin
- 1354650..1354716 + 67 NuclAT_24 - Antitoxin
- 1354652..1354715 + 64 NuclAT_26 - -
- 1354652..1354715 + 64 NuclAT_26 - -
- 1354652..1354715 + 64 NuclAT_26 - -
- 1354652..1354715 + 64 NuclAT_26 - -
- 1354652..1354715 + 64 NuclAT_28 - -
- 1354652..1354715 + 64 NuclAT_28 - -
- 1354652..1354715 + 64 NuclAT_28 - -
- 1354652..1354715 + 64 NuclAT_28 - -
- 1354652..1354715 + 64 NuclAT_30 - -
- 1354652..1354715 + 64 NuclAT_30 - -
- 1354652..1354715 + 64 NuclAT_30 - -
- 1354652..1354715 + 64 NuclAT_30 - -
- 1354652..1354715 + 64 NuclAT_32 - -
- 1354652..1354715 + 64 NuclAT_32 - -
- 1354652..1354715 + 64 NuclAT_32 - -
- 1354652..1354715 + 64 NuclAT_32 - -
- 1354652..1354715 + 64 NuclAT_34 - -
- 1354652..1354715 + 64 NuclAT_34 - -
- 1354652..1354715 + 64 NuclAT_34 - -
- 1354652..1354715 + 64 NuclAT_34 - -
- 1354652..1354715 + 64 NuclAT_36 - -
- 1354652..1354715 + 64 NuclAT_36 - -
- 1354652..1354715 + 64 NuclAT_36 - -
- 1354652..1354715 + 64 NuclAT_36 - -
- 1354652..1354717 + 66 NuclAT_38 - -
- 1354652..1354717 + 66 NuclAT_38 - -
- 1354652..1354717 + 66 NuclAT_38 - -
- 1354652..1354717 + 66 NuclAT_38 - -
- 1354652..1354717 + 66 NuclAT_40 - -
- 1354652..1354717 + 66 NuclAT_40 - -
- 1354652..1354717 + 66 NuclAT_40 - -
- 1354652..1354717 + 66 NuclAT_40 - -
EC042_RS06690 1355030..1355137 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1355190..1355251 + 62 NuclAT_27 - -
- 1355190..1355251 + 62 NuclAT_27 - -
- 1355190..1355251 + 62 NuclAT_27 - -
- 1355190..1355251 + 62 NuclAT_27 - -
- 1355190..1355251 + 62 NuclAT_29 - -
- 1355190..1355251 + 62 NuclAT_29 - -
- 1355190..1355251 + 62 NuclAT_29 - -
- 1355190..1355251 + 62 NuclAT_29 - -
- 1355190..1355251 + 62 NuclAT_31 - -
- 1355190..1355251 + 62 NuclAT_31 - -
- 1355190..1355251 + 62 NuclAT_31 - -
- 1355190..1355251 + 62 NuclAT_31 - -
- 1355190..1355251 + 62 NuclAT_33 - -
- 1355190..1355251 + 62 NuclAT_33 - -
- 1355190..1355251 + 62 NuclAT_33 - -
- 1355190..1355251 + 62 NuclAT_33 - -
- 1355190..1355251 + 62 NuclAT_35 - -
- 1355190..1355251 + 62 NuclAT_35 - -
- 1355190..1355251 + 62 NuclAT_35 - -
- 1355190..1355251 + 62 NuclAT_35 - -
- 1355190..1355251 + 62 NuclAT_37 - -
- 1355190..1355251 + 62 NuclAT_37 - -
- 1355190..1355251 + 62 NuclAT_37 - -
- 1355190..1355251 + 62 NuclAT_37 - -
- 1355190..1355252 + 63 NuclAT_15 - -
- 1355190..1355252 + 63 NuclAT_15 - -
- 1355190..1355252 + 63 NuclAT_15 - -
- 1355190..1355252 + 63 NuclAT_15 - -
- 1355190..1355252 + 63 NuclAT_17 - -
- 1355190..1355252 + 63 NuclAT_17 - -
- 1355190..1355252 + 63 NuclAT_17 - -
- 1355190..1355252 + 63 NuclAT_17 - -
- 1355190..1355252 + 63 NuclAT_19 - -
- 1355190..1355252 + 63 NuclAT_19 - -
- 1355190..1355252 + 63 NuclAT_19 - -
- 1355190..1355252 + 63 NuclAT_19 - -
- 1355190..1355252 + 63 NuclAT_21 - -
- 1355190..1355252 + 63 NuclAT_21 - -
- 1355190..1355252 + 63 NuclAT_21 - -
- 1355190..1355252 + 63 NuclAT_21 - -
- 1355190..1355252 + 63 NuclAT_23 - -
- 1355190..1355252 + 63 NuclAT_23 - -
- 1355190..1355252 + 63 NuclAT_23 - -
- 1355190..1355252 + 63 NuclAT_23 - -
- 1355190..1355252 + 63 NuclAT_25 - -
- 1355190..1355252 + 63 NuclAT_25 - -
- 1355190..1355252 + 63 NuclAT_25 - -
- 1355190..1355252 + 63 NuclAT_25 - -
- 1355190..1355253 + 64 NuclAT_39 - -
- 1355190..1355253 + 64 NuclAT_39 - -
- 1355190..1355253 + 64 NuclAT_39 - -
- 1355190..1355253 + 64 NuclAT_39 - -
- 1355190..1355253 + 64 NuclAT_41 - -
- 1355190..1355253 + 64 NuclAT_41 - -
- 1355190..1355253 + 64 NuclAT_41 - -
- 1355190..1355253 + 64 NuclAT_41 - -
EC042_RS06695 1355543..1356643 - 1101 WP_001366250.1 sodium-potassium/proton antiporter ChaA -
EC042_RS06700 1356913..1357143 + 231 WP_001146444.1 putative cation transport regulator ChaB -
EC042_RS06705 1357301..1357996 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
EC042_RS06710 1358040..1358393 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4071.90 Da        Isoelectric Point: 11.4779

>T27188 WP_014639145.1 NC_017626:c1354602-1354495 [Escherichia coli 042]
MTLAQFAMIFWHDLAAPILTGIITAVIVSWWRNRK

Download         Length: 108 bp

>T27188 NC_017626:c1354602-1354495 [Escherichia coli 042]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGACGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT27188 NC_017626:1354650-1354716 [Escherichia coli 042]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References