Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 1354495..1354716 | Replicon | chromosome |
| Accession | NC_017626 | ||
| Organism | Escherichia coli 042 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | - |
| Locus tag | EC042_RS30035 | Protein ID | WP_014639145.1 |
| Coordinates | 1354495..1354602 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 1354650..1354716 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC042_RS06660 | 1350339..1351421 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| EC042_RS06665 | 1351421..1352254 | + | 834 | WP_000456447.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| EC042_RS06670 | 1352251..1352643 | + | 393 | WP_000200387.1 | invasion regulator SirB2 | - |
| EC042_RS06675 | 1352647..1353456 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| EC042_RS06680 | 1353492..1354346 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| EC042_RS30035 | 1354495..1354602 | - | 108 | WP_014639145.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1354650..1354716 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1354650..1354716 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1354652..1354715 | + | 64 | NuclAT_26 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_26 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_26 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_26 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_28 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_28 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_28 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_28 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_30 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_30 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_30 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_30 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_32 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_32 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_32 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_32 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_34 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_34 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_34 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_34 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_36 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_36 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_36 | - | - |
| - | 1354652..1354715 | + | 64 | NuclAT_36 | - | - |
| - | 1354652..1354717 | + | 66 | NuclAT_38 | - | - |
| - | 1354652..1354717 | + | 66 | NuclAT_38 | - | - |
| - | 1354652..1354717 | + | 66 | NuclAT_38 | - | - |
| - | 1354652..1354717 | + | 66 | NuclAT_38 | - | - |
| - | 1354652..1354717 | + | 66 | NuclAT_40 | - | - |
| - | 1354652..1354717 | + | 66 | NuclAT_40 | - | - |
| - | 1354652..1354717 | + | 66 | NuclAT_40 | - | - |
| - | 1354652..1354717 | + | 66 | NuclAT_40 | - | - |
| EC042_RS06690 | 1355030..1355137 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 1355190..1355251 | + | 62 | NuclAT_27 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_27 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_27 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_27 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_29 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_29 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_29 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_29 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_31 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_31 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_31 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_31 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_33 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_33 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_33 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_33 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_35 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_35 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_35 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_35 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_37 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_37 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_37 | - | - |
| - | 1355190..1355251 | + | 62 | NuclAT_37 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_15 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_15 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_15 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_15 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_17 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_17 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_17 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_17 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_19 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_19 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_19 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_19 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_21 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_21 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_21 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_21 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_23 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_23 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_23 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_23 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_25 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_25 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_25 | - | - |
| - | 1355190..1355252 | + | 63 | NuclAT_25 | - | - |
| - | 1355190..1355253 | + | 64 | NuclAT_39 | - | - |
| - | 1355190..1355253 | + | 64 | NuclAT_39 | - | - |
| - | 1355190..1355253 | + | 64 | NuclAT_39 | - | - |
| - | 1355190..1355253 | + | 64 | NuclAT_39 | - | - |
| - | 1355190..1355253 | + | 64 | NuclAT_41 | - | - |
| - | 1355190..1355253 | + | 64 | NuclAT_41 | - | - |
| - | 1355190..1355253 | + | 64 | NuclAT_41 | - | - |
| - | 1355190..1355253 | + | 64 | NuclAT_41 | - | - |
| EC042_RS06695 | 1355543..1356643 | - | 1101 | WP_001366250.1 | sodium-potassium/proton antiporter ChaA | - |
| EC042_RS06700 | 1356913..1357143 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| EC042_RS06705 | 1357301..1357996 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| EC042_RS06710 | 1358040..1358393 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4071.90 Da Isoelectric Point: 11.4779
>T27188 WP_014639145.1 NC_017626:c1354602-1354495 [Escherichia coli 042]
MTLAQFAMIFWHDLAAPILTGIITAVIVSWWRNRK
MTLAQFAMIFWHDLAAPILTGIITAVIVSWWRNRK
Download Length: 108 bp
>T27188 NC_017626:c1354602-1354495 [Escherichia coli 042]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGACGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGACGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT27188 NC_017626:1354650-1354716 [Escherichia coli 042]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|