Detailed information of TA system TA271865

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 51851..52126
• Replicon: plasmid pEA16-3_1
• Accession: NZ_CP117648
• Organism: Escherichia albertii strain BIA_16-3

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: PS048_RS23880
• Protein ID: WP_072247442.1
• Coordinates: 51956..52126 (+)
• Length: 57 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	51851..51912 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS048_RS23850 (48570)	48570..49310	+	741	WP_059257080.1	conjugal transfer pilus acetylase TraX	-
PS048_RS23855 (49365)	49365..49925	+	561	WP_059257079.1	fertility inhibition protein FinO	-
PS048_RS23860 (50061)	50061..50273	+	213	WP_059257078.1	ANR family transcriptional regulator	-
PS048_RS23865 (50519)	50519..50870	+	352	Protein_56	thermonuclease family protein	-
PS048_RS23870 (50905)	50905..51114	+	210	WP_059257077.1	hemolysin expression modulator Hha	-
PS048_RS23875 (51319)	51319..51756	+	438	WP_059257076.1	hypothetical protein	-
- (51851)	51851..51912	-	62	NuclAT_0	-	Antitoxin
- (51851)	51851..51912	-	62	NuclAT_0	-	Antitoxin
- (51851)	51851..51912	-	62	NuclAT_0	-	Antitoxin
- (51851)	51851..51912	-	62	NuclAT_0	-	Antitoxin
PS048_RS23880 (51956)	51956..52126	+	171	WP_072247442.1	Hok/Gef family protein	Toxin
PS048_RS23885 (52693)	52693..54372	+	1680	WP_077871554.1	group II intron reverse transcriptase/maturase	-
PS048_RS23890 (54786)	54786..55088	+	303	WP_072146426.1	DUF1778 domain-containing protein	-
PS048_RS23895 (55079)	55079..55561	+	483	WP_059257273.1	GNAT family N-acetyltransferase	-
PS048_RS23900 (55872)	55872..56126	+	255	WP_273786639.1	replication regulatory protein RepA	-
PS048_RS23905 (56362)	56362..56436	+	75	WP_001375168.1	RepA leader peptide Tap	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	-	1..82983	82983

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 57 a.a.
• Molecular weight: 6367.59 Da
• Isoelectric Point: 8.2760

>T271865 WP_072247442.1 NZ_CP117648:51956-52126 [Escherichia albertii]
MTKYALIGLLAVCATVLFFSLIFRERLCELNIHRGNTVVQVTLAYECDKKSSNILF

Nucleotide

• Length: 171 bp

Antitoxin

Nucleotide

• Length: 62 bp

>AT271865 NZ_CP117648:c51912-51851 [Escherichia albertii]
TTGAGATACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin