Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-OrzO/SymE(toxin) |
| Location | 4052213..4052625 | Replicon | chromosome |
| Accession | NZ_CP117647 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | A0A828GM97 |
| Locus tag | PS048_RS19850 | Protein ID | WP_054409947.1 |
| Coordinates | 4052284..4052625 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | OrzO | ||
| Locus tag | - | ||
| Coordinates | 4052213..4052289 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS19840 (4047353) | 4047353..4048711 | + | 1359 | WP_273785054.1 | restriction endonuclease subunit S | - |
| PS048_RS19845 (4048806) | 4048806..4052069 | + | 3264 | WP_273785056.1 | HsdR family type I site-specific deoxyribonuclease | - |
| - (4052213) | 4052213..4052289 | - | 77 | NuclAT_4 | - | Antitoxin |
| - (4052213) | 4052213..4052289 | - | 77 | NuclAT_4 | - | Antitoxin |
| - (4052213) | 4052213..4052289 | - | 77 | NuclAT_4 | - | Antitoxin |
| - (4052213) | 4052213..4052289 | - | 77 | NuclAT_4 | - | Antitoxin |
| - (4052213) | 4052213..4052289 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4052213) | 4052213..4052289 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4052213) | 4052213..4052289 | - | 77 | NuclAT_5 | - | Antitoxin |
| - (4052213) | 4052213..4052289 | - | 77 | NuclAT_5 | - | Antitoxin |
| PS048_RS19850 (4052284) | 4052284..4052625 | + | 342 | WP_054409947.1 | endoribonuclease SymE | Toxin |
| PS048_RS19855 (4052672) | 4052672..4053529 | - | 858 | Protein_3877 | DUF1524 domain-containing protein | - |
| PS048_RS19860 (4053715) | 4053715..4054647 | - | 933 | WP_059257983.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| PS048_RS19865 (4054834) | 4054834..4056114 | + | 1281 | WP_273785059.1 | DUF445 domain-containing protein | - |
| PS048_RS19870 (4056234) | 4056234..4057385 | + | 1152 | WP_266118556.1 | double-cubane-cluster-containing anaerobic reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12309.18 Da Isoelectric Point: 9.0984
>T271860 WP_054409947.1 NZ_CP117647:4052284-4052625 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAIDVKVMEGCIVLTAQPPAAKESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAIDVKVMEGCIVLTAQPPAAKESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271860 NZ_CP117647:c4052289-4052213 [Escherichia albertii]
AGTCATAACTGCTATTCCTTCGAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCTTCGAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|